KEGG   Mus musculus (mouse): 381413Help
Entry
381413            CDS       T01002                                 

Gene name
Gpr176, Gm1012
Definition
(RefSeq) G protein-coupled receptor 176
  KO
K08442  
G protein-coupled receptor 176
Organism
mmu  Mus musculus (mouse)
Brite
G protein-coupled receptors [BR:mmu04030]
 Class A. Rhodopsin family
  Other
   Putative / unclassified Class A GPCRs
    381413 (Gpr176)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
MGI: 
Ensembl: 
Vega: 
UniProt: 
Position
2; 2 E5
AA seq 515 aa AA seqDB search
MGHNSSWVSPNTSHPRNTSGAEAGANLSAFGELSEAQLYRQFTTTVQVVIFIGSLLGNFM
VLWSTCRTTVFKSVTNRFIKNLACSGICASVVCVPFDIILSSSPHCCWWIYTMLFCKVLK
FLHKVFCSVTVLSFPAIALDRYYSVLYPLERKISDAKSRELVMYIWAHAVVASVPVFAVT
NVADIYAMSTCTEVWSNSLGHLVYVLIYNVTTVIVPVAVVFLFLILIRRALSASQKKKVI
IAALRTPQNTISIPYASQREAELHATLLSMVTVFILCSVPYATLVVYQTVLNVPNTSVFL
LLTAIWLPKVSLLANPVLFLTVNKSVRKCLVGTLVQLHHRYSRRNVVSTGSGVAEPSLEP
SMRSGSQLLEMFHIGQQQIFKPSEDEEESEAKYLGSADFQAKEVLTSCPEGEQEPPQLAP
SVPPPGTVDSEPRVSPVAPMESGIFPDKYSLQFGFGPFELPPQWLSETRNSKKRLLPPLG
NTPEELIQTKVPRVNRVERKMSRNNKVSIFPKVDS
NT seq 1548 nt NT seq  +upstreamnt  +downstreamnt
atggggcacaacagcagctgggtgtcaccgaacaccagccacccgcgcaacacgtcgggc
gccgaggctggcgccaacctcagcgcgttcggggagctgagcgaggctcagctgtaccgc
cagttcaccaccaccgtgcaggtcgtcatcttcattggctcgctactgggaaacttcatg
gtgttatggtcaacttgccgcacaacagtgttcaaatctgtcaccaacaggttcattaaa
aacctggcctgctccgggatttgtgccagtgtggtctgtgtgcccttcgacatcatcctg
agcagcagccctcactgttgctggtggatctatacgatgctcttctgcaaggtgctcaaa
ttcctacacaaggtgttctgctctgtgactgtcctcagttttcctgctattgccctggac
aggtactattcagtcctttatcctctggagagaaaaatatctgatgccaagtctcgggag
ctagtgatgtacatctgggctcatgcagtggtggccagtgtccctgtgtttgctgtgacc
aatgtcgctgacatctatgctatgtccacctgcacggaagtctggagcaactccttgggc
cacctggtgtatgttctgatctacaatgtcaccacagtcattgtgcccgtggctgtggta
tttctctttctcatcctgatccggagggccctgagtgccagccagaagaagaaagtcata
attgctgcactgaggaccccacagaacaccatctctatcccctatgcttcccagcgagag
gcagagctacatgccaccctgctctccatggtgacagttttcattctctgcagtgtaccc
tatgccaccctggttgtctaccagactgtgctcaatgtacctaacacctctgtcttcttg
cttctcacggccatttggctgcccaaagtctctctgttggccaaccctgtgctcttctta
actgtgaacaaatcggtacgcaagtgcttggtggggaccctggtgcagttgcaccaccgg
tacagtcgccgcaatgtggttagtacagggagtggggtggctgagcccagccttgagccc
agcatgcgctctggtagccagctcttggagatgttccacattgggcagcaacagatcttt
aagccctcggaggatgaggaagaaagtgaggccaagtatctcggctcagccgatttccag
gcaaaggaggtgctcacttcctgcccagagggcgagcaggagccaccacagcttgcaccg
tctgtgccacctccaggcacagtggactctgaacctcgggtgtccccagtagctcccatg
gaatctgggatatttcctgataagtattccctgcagtttggctttgggccttttgagtta
ccccctcagtggctctctgagacccgaaatagcaagaagaggctgcttcccccactgggc
aataccccagaagagctgatccagacaaaggtgcccagagtgaacagggtggaacggaag
atgagcagaaacaataaagtgagcatttttccaaaggtagactcctag

DBGET integrated database retrieval system