KEGG   Mus musculus (mouse): 381944Help
Entry
381944            CDS       T01002                                 

Gene name
Usp17lb, DUB-1A, Dub1a
Definition
ubiquitin specific peptidase 17-like B
Orthology
K11845  
ubiquitin carboxyl-terminal hydrolase 17 [EC:3.1.2.15]
Organism
mmu  Mus musculus (mouse)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
MGI: 
Ensembl: 
UniProt: 
Position
7 E3; 7
AA seq 468 aa AA seqDB search
MVVALSFPEADPAMSPPSAPELHQDEAQVVEELAANGKHSLSWESPQGPGCGLQNTGNSC
YLNAALQCLTHTPPLADYMLSQEHSQTCCSPEGCKMCAMEAHVTQSLLHTHSGDVMKPSQ
NLTSAFHKRKQEDAHEFLMFTLETMHESCLQVHRQSEPTSEDSSPIHDIFGGWWRSQIKC
HHCQGTSYSYDPFLDIPLDISSVQSVKQALQDTEKAEELCGENSYYCGRCRQKKPASKTL
KLYSAPKVLMLVLKRFSGSMGKKLDRKVSYPEFLDLKPYLSQPTGGPLPYALYAVLVHEG
ATCHSGHYFCCVKAGHGKWYKMDDTKVTSCDVTSVLNENAYVLFYVQQNDLKKGSINMPE
GRIHEVLDAKYQLKKSGEKKHNKSPCTEDAGEPCENREKRSSKETSLGEGKVLQEQDHQK
AGQKQENTKLTPQEQNHEKGGQNLRNTEGELDRLSGAIVVYQPICTAN
NT seq 1407 nt NT seq  +upstreamnt  +downstreamnt
atggtggttgctctctccttcccagaagcagatccagccatgtcacctcctagtgcccca
gagctgcatcaggatgaagcccaggtggtagaggagctggctgccaatggaaagcacagt
ctgagttgggagagtccccaaggaccaggatgcgggctccagaacacaggcaacagctgc
tacctgaatgcagccctgcagtgcttgacacacacaccacctctagctgactacatgctg
tcccaggagcacagtcaaacctgttgttccccagaaggctgtaagatgtgtgctatggaa
gcccatgtgacccagagtctcctgcacacccactcaggggatgttatgaagccctcccag
aatttgacctctgccttccacaagcgcaagcaggaagatgcccatgagtttctcatgttc
accttggaaacaatgcatgaatcctgccttcaagtgcacagacaatcagaacccacctct
gaggacagctcacccattcatgacatatttggaggctggtggaggtctcagatcaagtgt
caccactgccagggcacctcatattcctatgatcccttcctggacatccccctggatatc
agctcagttcagagtgtgaagcaagccttgcaggatacagagaaggcagaagagctatgt
ggggagaattcctactactgtggtaggtgtagacaaaagaagccagcttccaagacccta
aagctttatagtgccccaaaggtactcatgctagtgttaaagcgcttttcgggctctatg
ggtaaaaagttggacagaaaagtaagctacccagagttccttgacctgaagccatacctg
tcccagcctactggagggcctttgccttatgccctctatgccgtcctggtccatgaaggt
gcaacttgtcacagtggacattacttctgttgtgtcaaagctggccatgggaagtggtac
aagatggatgatactaaggtcaccagctgtgatgtgacttctgtcctgaatgagaatgcc
tatgtgctcttctatgtgcagcagaatgacctcaaaaagggtagtatcaacatgccagag
ggcagaatacatgaggttcttgatgccaaataccagctgaagaaatcaggggaaaaaaag
cataataaaagcccttgcacagaagatgcaggagagccctgcgaaaacagggagaagaga
tcatccaaagaaacctccttaggggaggggaaagttcttcaggaacaggaccaccagaaa
gctgggcagaaacaagagaataccaaactcacgcctcaggaacagaaccacgagaaaggt
gggcagaacctcaggaatactgaaggtgaacttgatcgactcagtggtgcaattgtggtt
taccaacctatatgcactgcaaactga

DBGET integrated database retrieval system