KEGG   Mus musculus (mouse): 382018Help
Entry
382018            CDS       T01002                                 

Gene name
Unc13a, 2410078G03Rik, Munc13-1
Definition
unc-13 homolog A (C. elegans)
Orthology
K15293  
protein unc-13
Organism
mmu  Mus musculus (mouse)
Pathway
Synaptic vesicle cycle
Brite
KEGG Orthology (KO) [BR:mmu00001]
 Organismal Systems
  Nervous system
   04721 Synaptic vesicle cycle
    382018 (Unc13a)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
MGI: 
UniProt: 
Position
8 B3.3; 8
AA seq 1712 aa AA seqDB search
MSLLCVGVKKAKFDGAQEKFNTYVTLKVQNVKSTTIAVRGSQPSWEQDFMFEINRLDLGL
TVEVWNKGLIWDTMVGTVWIPLRTIRQSNEEGPGEWLTLDSQAIMADSEICGTKDPTFHR
ILLDAHFELPLDIPEEEARYWAKKLEQLNAMRDQDEYSFQDQQDKPLPVPSSQCCNWNYF
GWGEQNDDPDSAVDDRDSDYRSETSNSIPPPYYTTSQPNASVHQYSVRPPPLGSRESYSD
SMHSYEEFSEPRALSPTGSSRYASSGELSQGSSQLSEDFDPDEHSLQGSELDDERDRDSY
HSCHSSVSYHKDSPRWDQDDEDLEDLEDLEDEELPEEEEELEEEGEEELEEEDLEEEEEV
PDDLASYTQQEDTTVAEPKEFKRISFPTAAPQKDDKVSAVPTEAPEVAKGIPKAATPEEK
AAAERAQEAEPPKSEESFRSREEEEGQEGQDAMSRAKANWLRAFNKVRMQLQEARGEGDM
SKSLWFKGGPGGGLIIIDSMPDIRKRKPIPLVSDLAMSLVQSRKAGITSALASSTLNNEE
LKNHVYKKTLQALIYPISCTTPHNFEVWTATTPTYCYECEGLLWGIARQGMRCTECGVKC
HEKCQDLLNADCLQRAAEKSSKHGAEDRTQNIIMVLKDRMKIRERNKPEIFELIQEIFAV
TKSAHTQQMKAVKQSVLDGTSKWSAKISITVVCAQGLQAKDKTGSSDPYVTVQVGKTKKR
TKTIYGNLNPVWEENFHFECHNSSDRIKVRVWDEDDDIKSRVKQRFKRESDDFLGQTIIE
VRTLSGEMDVWYNLDKRTDKSAVSGAIRLHISVEIKGEEKVAPYHVQYTCLHENLFHFVT
DVQNNGVVKIPDAKGDDAWKVYYDETAQEIVDEFAMRYGVESIYQAMTHFACLSSKYMCP
GVPAVMSTLLANINAYYAHTTASTNVSASDRFAASNFGKERFVKLLDQLHNSLRIDLSMY
RNNFPASSPERLQDLKSTVDLLTSITFFRMKVQELQSPPRASQVVKDCVKACLNSTYEYI
FNNCHELYGREYQTDPAKKGEVPPEEQGPSIKNLDFWSKLITLIVSIIEEDKNSYTPCLN
QFPQELNVGKISAEVMWSLFAQDMKYAMEEHDKHRLCKSADYMNLHFKVKWLYNEYVAEL
PTFKDRVPEYPAWFEPFVIQWLDENEEVSRDFLHGALERDKKDGFQQTSEHALFSCSVVD
VFSQLNQSFEIIKKLECPDPQIVGHYMRRFAKTISNVLLQYADIVSKDFASYCSKEKEKV
PCILMNNTQQLRVQLEKMFEAMGGKELDAEASGTLKELQVKLNNVLDELSHVFATSFQPH
IEECVRQMGDILSQVKGTGNVPASACSSVAQDADNVLQPIMDLLDSNLTLFAKICEKTVL
KRVLKELWKLVMNTMEKTIVLPPLTDQTMIGTLLRKHGKGLEKGRVKLPSHSDGTQMIFN
AAKELGQLSKLKDHMVREEAKSLTPKQCAVVELALDTIKQYFHAGGVGLKKTFLEKSPDL
QSLRYALSLYTQATDLLIKTFVQTQSAQGSGVEDPVGEVSVHVELFTHPGTGEQKVTVKV
VAANDLKWQTSGIFRPFIEVNIVGPQLSDKKRKFATKSKNNSWAPKYNESFQFSLSADAG
PECYELQVCVKDYCFAREDRTVGLAVLQLRELAQRGSAACWLPLGRRIHMDDTGLTVLRI
LSQRSNDEVAKEFVKLKSDTRSAEEGGAAPAP
NT seq 5139 nt NT seq  +upstreamnt  +downstreamnt
atgtctctgctgtgcgtgggagtcaaaaaagccaagtttgacggtgcccaagagaagttc
aacacatacgtgacgctgaaggtgcagaacgtgaagagcactaccatagctgtacgtggc
agccagcccagctgggagcaggacttcatgtttgagatcaaccgcctggatctaggcctg
accgtggaggtgtggaacaagggtctcatctgggacacgatggtgggtactgtgtggatc
ccgctgcggaccatccgccagtccaatgaggagggcccaggagagtggctcacactggac
tctcaggccatcatggcggacagtgagatctgtgggaccaaggaccccaccttccatcgc
atcctcctggacgctcatttcgagctgccgttggacatccctgaggaggaggcacgctac
tgggccaagaagctggagcagctgaatgccatgcgtgaccaggatgagtactccttccag
gaccagcaggacaagccgctgccagtgcccagcagccagtgctgcaactggaattacttt
ggctggggagaacagaatgacgaccccgacagtgcggtggatgaccgggacagtgactat
aggagtgagaccagcaacagcatcccaccgccctactatacgacttcgcagcccaacgcc
tctgtgcaccagtactccgtgcgaccgccccctctggggtcccgggagtcctacagtgac
tccatgcacagctatgaggagttctctgagccgcgggcgctcagccccacaggcagcagc
cgctatgcttcttccggggagctgagccagggaagctcacagctgagcgaggacttcgac
cctgatgagcacagcctgcagggctcggagctggatgacgagagggaccgcgattcttat
cactcctgtcacagctccgtgagttaccacaaggactcaccccgctgggaccaggacgat
gaggacctggaggacctggaggacctggaagatgaggagctgcccgaggaggaggaggag
ttggaggaggagggggaggaggaattggaggaagaggatttggaggaggaggaggaggtg
cctgatgacctggccagctacacccagcaggaggacaccactgtggctgagcccaaagag
ttcaagcggatcagcttcccaacggctgcgcctcagaaggatgacaaggtttcagctgtg
cctacagaggcccccgaggtggccaaaggcatccccaaagcagccacacccgaggagaag
gcagctgcagagcgtgcgcaggaagccgagccccccaagtctgaggagagtttcagatct
cgagaggaggaagagggccaggaagggcaggatgccatgtccagagccaaagccaactgg
ttgcgagccttcaacaaggtgcgcatgcagctgcaggaggcccgaggagaaggggatatg
tctaagtctctatggttcaaaggcggtcctggtggtggccttatcatcattgacagcatg
ccagacatcaggaaacggaagcccattcccctcgtgagcgacctggctatgtcattggtg
cagtctcggaaggcaggcatcacctcggccttggcctccagcacgttgaacaatgaagag
ctgaaaaatcacgtttacaagaagaccctgcaagccttaatctaccccatctcctgcacc
acgccgcacaatttcgaggtgtggacggccaccacgcccacctactgctatgagtgcgag
gggctgctgtggggcatcgcgcggcagggcatgcgatgcaccgagtgcggcgttaagtgc
cacgagaagtgccaggacctgctcaatgcggattgcctgcagcgggcggctgagaagagt
tccaagcatggcgctgaagaccgcacgcagaacatcatcatggtgctgaaggaccgcatg
aagatccgcgagcgcaacaagcctgagatcttcgagcttatccaagagatcttcgcggtc
accaagagcgcacacacacagcagatgaaagctgtcaagcagagtgtgctggacggcaca
tccaagtggtctgccaaaattagcatcacagtggtctgtgcccagggcttgcaggccaag
gacaagacaggatccagtgacccttatgtcaccgtccaggttgggaagaccaagaaaagg
acaaaaaccatctacgggaacctcaacccagtgtgggaagagaattttcattttgaatgt
cacaactcctctgaccggatcaaggttcgtgtttgggatgaagatgacgacataaaatcc
cgtgtgaaacaaaggtttaagagggagtctgatgacttcctagggcagacaatcatcgag
gtgcggacgcttagcggcgagatggatgtgtggtacaatctggacaagagaacggacaag
tcggcggtgtcgggggccatccggcttcacatcagtgtggagatcaaaggggaggagaag
gtggcgccctaccatgtccagtacacctgtctgcatgagaacctgttccactttgtgacg
gacgtgcagaacaatggtgtggtgaagattcccgatgccaagggtgacgacgcctggaag
gtttactacgatgagacggcccaggagatcgtggatgagtttgccatgcgctatggtgtt
gagtccatctaccaagccatgacccactttgcctgcctctcctccaagtatatgtgccct
ggggtacccgctgtcatgagcaccctgcttgccaacatcaacgcctactacgcacacacc
accgcctccaccaacgtgtctgcctctgaccgcttcgctgcctctaatttcgggaaagag
cgctttgtgaaacttctggaccagctacacaattctctgcggatcgacctgtccatgtac
cggaacaacttcccagccagcagccctgagcggctgcaggatctcaagtccacggtggac
ctgctcaccagcatcaccttcttccggatgaaggttcaggaactgcagagcccgccgcgt
gccagccaggtagtgaaagactgtgtgaaggcctgcctcaactccacctatgagtacatc
ttcaacaactgccatgagctctatggccgggagtaccaaacggatccggccaagaagggg
gaggttcccccagaggagcaaggccctagcatcaagaacctggatttctggtccaagctg
atcaccctcatcgtgtctatcatcgaggaggataagaattcttacacaccctgcctcaat
cagtttccccaggagctcaatgtggggaagatcagtgctgaggtgatgtggagcctattt
gcccaagacatgaagtacgccatggaggaacatgacaaacaccggctgtgtaagagcgca
gattacatgaacctgcacttcaaggtgaagtggctgtacaatgagtacgtggccgagctg
cccaccttcaaggaccgtgtgcctgagtaccctgcgtggtttgagcccttcgtcatccag
tggttggatgagaatgaggaggtgtcccgggacttcctgcatggtgccctcgagcgggac
aagaaggacgggttccagcagacctcagagcacgccctgttctcttgctcagtggtggac
gtcttctcccagcttaaccagagtttcgagatcatcaagaagctggagtgtcctgacccc
cagatcgtgggccattacatgcggcgttttgccaagaccattagcaatgtgcttctccag
tatgcagacatcgtttccaaggacttcgcctcctactgctccaaggagaaggagaaagtg
ccctgcatcctcatgaacaacacacagcaactacgagtgcagctggagaagatgtttgag
gcgatgggcgggaaggagctggatgccgaggccagtggcaccctgaaggagctgcaggtg
aaactcaacaatgtcctggatgaactcagccatgtgtttgccaccagcttccagccacac
attgaggaatgcgtcagacagatgggtgacatcctgagccaggtgaagggcacaggcaat
gtacctgccagtgcctgcagcagcgtggcccaggatgcagacaatgtgctgcagcccatc
atggatcttctggacagcaacctcaccctgtttgccaaaatctgtgagaagacagttctg
aagcgggtgctgaaggagctctggaagctggtgatgaacacaatggagaagaccatcgtc
ctgccaccgctcactgaccagacgatgattggcaccctcttgagaaaacatggcaagggc
ctagaaaagggcagggtgaaactgccaagccactcagacgggacacaaatgatcttcaat
gctgccaaggagctgggccagctgtccaaacttaaggatcacatggtgcgggaagaagcc
aagagcttgaccccgaagcagtgtgctgttgttgaactggccctggacaccatcaagcaa
tacttccacgcggggggcgttggcctcaagaagaccttcctggagaagagcccggacctc
cagtccctgcgctacgccctgtcgctctacacgcaagccaccgacctgctcatcaaaacc
ttcgtgcagacgcagtcagcgcagggctctggtgtggaggaccctgtaggtgaagtgtcc
gtccacgtggagctgttcacacatccaggaactggggaacagaaggtcacagtgaaggtg
gtggccgccaatgacctcaagtggcagacttctggcatcttccgcccgttcatcgaggtc
aacatcgttggacctcagcttagcgacaagaaacgcaagttcgccaccaaatccaaaaac
aacagctgggcgcccaagtataacgagagcttccagttctccctgagcgccgacgcgggc
cccgagtgctacgagctgcaggtgtgcgtgaaggactactgctttgcgcgcgaagaccgc
acggtggggctggcggtgctgcaactgcgagagctggcccagcgcgggagcgccgcgtgc
tggcttccactcggccgccgcatccacatggacgacacggggctcacagtgctgcgcatc
ctgtcgcagcgcagcaacgatgaggtggccaaggaattcgtcaagctcaagtcggacacg
cgctcagccgaggagggcggtgccgcgcctgcgccctag

DBGET integrated database retrieval system