KEGG   Mus musculus (mouse): 382522Help
Entry
382522            CDS       T01002                                 

Gene name
Hist3h2bb-ps, 4930534G10Rik, 4933432H21, B2Hist3h2bb, Hist3h2bb, R75370
Definition
histone cluster 3, H2bb, pseudogene
Orthology
K11252  
histone H2B
Organism
mmu  Mus musculus (mouse)
Pathway
Alcoholism
Viral carcinogenesis
Systemic lupus erythematosus
Class
Human Diseases; Cancers; Viral carcinogenesis [PATH:mmu05203]
Human Diseases; Immune diseases; Systemic lupus erythematosus [PATH:mmu05322]
Human Diseases; Substance dependence; Alcoholism [PATH:mmu05034]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
MGI: 
UniProt: 
Position
11 B2; 11
AA seq 154 aa AA seqDB search
MPDPSFECKAYKYSCYRGVRVSVVQLDIMPDPSKSAPAPKKGSKKAVTKAQKKDGKKRKR
GRKESYSIYVYKVLKQVHPDTGISSKAMGIMNSFVNDIFERIASEASRLAHYNKRSTITS
REVQTAVRLLLPGELAKHAVSEGTKAVTKYTSSK
NT seq 465 nt NT seq  +upstreamnt  +downstreamnt
atgcctgatccttcatttgaatgcaaggcatacaaatattcttgctacaggggcgtccgc
gtttccgtagtacaactagacattatgcctgatccatccaaatcagctccagcccccaag
aaaggctccaaaaaggcggtcaccaaggcgcagaaaaaggatggcaagaaacgcaaacgg
ggccgcaaggagagctactccatctacgtgtacaaggtgctgaagcaggtgcatccggac
accggcatctcgtctaaggccatgggcatcatgaactcgttcgtcaatgacatcttcgag
cgcatcgccagcgaggcctcccgcctggcgcattacaacaagcgctcgaccatcacgtcc
cgcgaggtgcagacagccgtgcgcctgctgctgcccggggagctggccaagcatgctgtg
tccgagggcaccaaggcagtcaccaaatacaccagctccaagtga

DBGET integrated database retrieval system