KEGG   Mus musculus (mouse): 382522Help
Entry
382522            CDS       T01002                                 

Gene name
Hist3h2bb-ps, 4930534G10Rik, 4933432H21, B2Hist3h2bb, Hist3h2bb, R75370
Definition
histone cluster 3, H2bb, pseudogene
Orthology
K11252  
histone H2B
Organism
mmu  Mus musculus (mouse)
Pathway
Alcoholism
Viral carcinogenesis
Systemic lupus erythematosus
Brite
KEGG Orthology (KO) [BR:mmu00001]
 Human Diseases
  Cancers
   05203 Viral carcinogenesis
    382522 (Hist3h2bb-ps)
  Immune diseases
   05322 Systemic lupus erythematosus
    382522 (Hist3h2bb-ps)
  Substance dependence
   05034 Alcoholism
    382522 (Hist3h2bb-ps)
Exosome [BR:mmu04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   382522 (Hist3h2bb-ps)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
MGI: 
UniProt: 
Position
11 B2; 11
AA seq 154 aa AA seqDB search
MPDPSFECKAYKYSCYRGVRVSVVQLDIMPDPSKSAPAPKKGSKKAVTKAQKKDGKKRKR
GRKESYSIYVYKVLKQVHPDTGISSKAMGIMNSFVNDIFERIASEASRLAHYNKRSTITS
REVQTAVRLLLPGELAKHAVSEGTKAVTKYTSSK
NT seq 465 nt NT seq  +upstreamnt  +downstreamnt
atgcctgatccttcatttgaatgcaaggcatacaaatattcttgctacaggggcgtccgc
gtttccgtagtacaactagacattatgcctgatccatccaaatcagctccagcccccaag
aaaggctccaaaaaggcggtcaccaaggcgcagaaaaaggatggcaagaaacgcaaacgg
ggccgcaaggagagctactccatctacgtgtacaaggtgctgaagcaggtgcatccggac
accggcatctcgtctaaggccatgggcatcatgaactcgttcgtcaatgacatcttcgag
cgcatcgccagcgaggcctcccgcctggcgcattacaacaagcgctcgaccatcacgtcc
cgcgaggtgcagacagccgtgcgcctgctgctgcccggggagctggccaagcatgctgtg
tccgagggcaccaaggcagtcaccaaatacaccagctccaagtga

DBGET integrated database retrieval system