KEGG   Mus musculus (mouse): 382562Help
Entry
382562            CDS       T01002                                 

Gene name
Pfn4, 2900024P18Rik
Definition
profilin family, member 4
Orthology
K05759  
profilin
Organism
mmu  Mus musculus (mouse)
Pathway
Rap1 signaling pathway
Regulation of actin cytoskeleton
Salmonella infection
Brite
KEGG Orthology (KO) [BR:mmu00001]
 Environmental Information Processing
  Signal transduction
   04015 Rap1 signaling pathway
    382562 (Pfn4)
 Cellular Processes
  Cell motility
   04810 Regulation of actin cytoskeleton
    382562 (Pfn4)
 Human Diseases
  Infectious diseases
   05132 Salmonella infection
    382562 (Pfn4)
Exosome [BR:mmu04147]
 Exosomal proteins
  Proteins found in most exosomes
   382562 (Pfn4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
MGI: 
Ensembl: 
UniProt: 
Position
12 A1.1; 12
AA seq 129 aa AA seqDB search
MSHLQNLLLDTLLGTKHVDSAALIKLQEKTLCVTSPGFSVMPSDVRTLLNGFAKNPLLTR
REGLYFKEKDYKCVRADDYSLYAKNENTGVVVVKTNMYLVVATYTAGMYPSVCVEATEKL
GEYLRKKGN
NT seq 390 nt NT seq  +upstreamnt  +downstreamnt
atgagtcacttgcagaacttactgttagataccctgctggggacgaaacacgtggacagc
gcagccctcatcaaactccaggaaaagaccctgtgtgtgacatcaccaggatttagtgta
atgccaagtgatgttcgaacacttctgaatggatttgccaaaaacccattattaacgcga
agggaagggttgtatttcaaggagaaggattacaaatgtgttcgggcagatgactattct
ctctatgctaagaatgagaacactggtgtggtggtggtgaagaccaacatgtatcttgtg
gtggcaacttacactgcaggcatgtatcctagcgtctgcgtggaagccacagagaagctg
ggagagtatctaaggaaaaagggaaactaa

DBGET integrated database retrieval system