KEGG   Mus musculus (mouse): 382985Help
Entry
382985            CDS       T01002                                 

Gene name
Rrm2b, p53R2
Definition
(RefSeq) ribonucleotide reductase M2 B (TP53 inducible)
  KO
K10808  
ribonucleoside-diphosphate reductase subunit M2 [EC:1.17.4.1]
Organism
mmu  Mus musculus (mouse)
Pathway
Purine metabolism
Pyrimidine metabolism
Glutathione metabolism
Drug metabolism - other enzymes
Metabolic pathways
p53 signaling pathway
Brite
KEGG Orthology (KO) [BR:mmu00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    382985 (Rrm2b)
   00240 Pyrimidine metabolism
    382985 (Rrm2b)
  Metabolism of other amino acids
   00480 Glutathione metabolism
    382985 (Rrm2b)
  Xenobiotics biodegradation and metabolism
   00983 Drug metabolism - other enzymes
    382985 (Rrm2b)
 Cellular Processes
  Cell growth and death
   04115 p53 signaling pathway
    382985 (Rrm2b)
Enzymes [BR:mmu01000]
 1. Oxidoreductases
  1.17  Acting on CH or CH2 groups
   1.17.4  With a disulfide as acceptor
    1.17.4.1  ribonucleoside-diphosphate reductase
     382985 (Rrm2b)
DNA repair and recombination proteins [BR:mmu03400]
 Eukaryotic Type
  Other factors with a suspected DNA repair function
   Modulation of nucleotide pools
    382985 (Rrm2b)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
MGI: 
Ensembl: 
Vega: 
UniProt: 
Position
15; 15 B3.1
AA seq 351 aa AA seqDB search
MGDPERPEAARPEKGEQLCSETEENVVRSNEEPLLRKSSRRFVIFPIQYPDIWRMYKQAQ
ASFWTAEEVDLSKDLPHWNKLKSDEKYFISHILAFFAASDGIVNENLVERFSQEVQVPEA
RCFYGFQILIENVHSEMYSLLIDTYIRDPKKREFLFNAIETMPYVKKKADWALRWIADRK
STFGERVVAFAAVEGIFFSGSFAAIFWLKKRGLMPGLTFSNELISRDEGLHCDFACLMFQ
YLVNKPSEDRVREIIADAVQIEQEFLTEALPVGLIGMNCVLMKQYIEFVADRLLGELGFS
KIFQAENPFDFMENISLEGKTNFFEKRVSEYQRFAVMAETTDNVFTLDADF
NT seq 1056 nt NT seq  +upstreamnt  +downstreamnt
atgggcgacccggaaaggccggaagcggccaggccggagaagggtgagcaattgtgttcg
gagacagaagaaaatgtggtgaggtcaaatgaagagccactcctaagaaagagttcccga
cggttcgtcatctttccaatccagtatcctgatatctggagaatgtacaagcaagcacag
gcatctttctggacagcagaggaggttgacttgtcaaaggacctccctcactggaacaag
cttaaatccgacgagaagtattttatctcccacatcttagccttttttgcagccagtgat
ggaattgtaaatgaaaacttggtggagcgttttagtcaggaggtgcaggttccagaggct
cgctgcttctatggctttcagattctcatcgagaatgttcactcagagatgtacagttta
ctaatagacacttacatcagagatccaaagaaaagggaatttttatttaatgcaattgaa
acaatgccatatgttaagaaaaaagcggactgggctctgcgctggatagcagataggaaa
tctacttttggggaaagagtggtggcctttgctgctgtggaaggaattttcttctctgga
tcatttgctgcaatattctggctaaagaagagaggcctcatgcctggactgactttttca
aatgaactgatcagcagggatgaaggacttcactgtgactttgcctgcctgatgtttcag
tacttggtaaacaagccttcagaagatagagtgagggaaatcattgctgatgctgttcaa
atcgagcaggagtttttaacagaagccttgcctgttggcctcattggaatgaactgtgtt
ttgatgaaacagtacattgagtttgtagctgacagattacttggagaacttggattctca
aagatttttcaggcagaaaatccctttgattttatggagaacatttcattagaagggaaa
acaaatttctttgagaaacgagtttctgagtatcagcgatttgcagtcatggccgaaacc
acagataatgtcttcaccttggatgcagatttctaa

DBGET integrated database retrieval system