KEGG   Mus musculus (mouse): 382985Help
Entry
382985            CDS       T01002                                 

Gene name
Rrm2b, p53R2
Definition
(RefSeq) ribonucleotide reductase M2 B (TP53 inducible) (EC:1.17.4.1)
  KO
K10808  
ribonucleoside-diphosphate reductase subunit M2 [EC:1.17.4.1]
Organism
mmu  Mus musculus (mouse)
Pathway
Purine metabolism
Pyrimidine metabolism
Glutathione metabolism
Metabolic pathways
p53 signaling pathway
Brite
KEGG Orthology (KO) [BR:mmu00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    382985 (Rrm2b)
   00240 Pyrimidine metabolism
    382985 (Rrm2b)
  Metabolism of other amino acids
   00480 Glutathione metabolism
    382985 (Rrm2b)
 Cellular Processes
  Cell growth and death
   04115 p53 signaling pathway
    382985 (Rrm2b)
Enzymes [BR:mmu01000]
 1. Oxidoreductases
  1.17  Acting on CH or CH2 groups
   1.17.4  With a disulfide as acceptor
    1.17.4.1  ribonucleoside-diphosphate reductase
     382985 (Rrm2b)
DNA repair and recombination proteins [BR:mmu03400]
 Eukaryotic Type
  Other factors with a suspected DNA repair function
   Modulation of nucleotide pools
    382985 (Rrm2b)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
MGI: 
Ensembl: 
Vega: 
UniProt: 
Position
15; 15 B3.1
AA seq 351 aa AA seqDB search
MGDPERPEAARPEKGEQLCSETEENVVRSNEEPLLRKSSRRFVIFPIQYPDIWRMYKQAQ
ASFWTAEEVDLSKDLPHWNKLKSDEKYFISHILAFFAASDGIVNENLVERFSQEVQVPEA
RCFYGFQILIENVHSEMYSLLIDTYIRDPKKREFLFNAIETMPYVKKKADWALRWIADRK
STFGERVVAFAAVEGIFFSGSFAAIFWLKKRGLMPGLTFSNELISRDEGLHCDFACLMFQ
YLVNKPSEDRVREIIADAVQIEQEFLTEALPVGLIGMNCVLMKQYIEFVADRLLGELGFS
KIFQAENPFDFMENISLEGKTNFFEKRVSEYQRFAVMAETTDNVFTLDADF
NT seq 1056 nt NT seq  +upstreamnt  +downstreamnt
atgggcgacccggaaaggccggaagcggccaggccggagaagggtgagcaattgtgttcg
gagacagaagaaaatgtggtgaggtcaaatgaagagccactcctaagaaagagttcccga
cggttcgtcatctttccaatccagtatcctgatatctggagaatgtacaagcaagcacag
gcatctttctggacagcagaggaggttgacttgtcaaaggacctccctcactggaacaag
cttaaatccgacgagaagtattttatctcccacatcttagccttttttgcagccagtgat
ggaattgtaaatgaaaacttggtggagcgttttagtcaggaggtgcaggttccagaggct
cgctgcttctatggctttcagattctcatcgagaatgttcactcagagatgtacagttta
ctaatagacacttacatcagagatccaaagaaaagggaatttttatttaatgcaattgaa
acaatgccatatgttaagaaaaaagcggactgggctctgcgctggatagcagataggaaa
tctacttttggggaaagagtggtggcctttgctgctgtggaaggaattttcttctctgga
tcatttgctgcaatattctggctaaagaagagaggcctcatgcctggactgactttttca
aatgaactgatcagcagggatgaaggacttcactgtgactttgcctgcctgatgtttcag
tacttggtaaacaagccttcagaagatagagtgagggaaatcattgctgatgctgttcaa
atcgagcaggagtttttaacagaagccttgcctgttggcctcattggaatgaactgtgtt
ttgatgaaacagtacattgagtttgtagctgacagattacttggagaacttggattctca
aagatttttcaggcagaaaatccctttgattttatggagaacatttcattagaagggaaa
acaaatttctttgagaaacgagtttctgagtatcagcgatttgcagtcatggccgaaacc
acagataatgtcttcaccttggatgcagatttctaa

DBGET integrated database retrieval system