KEGG   Mus musculus (mouse): 384701Help
Entry
384701            CDS       T01002                                 

Gene name
Usp17ld, Dub2a, Dub4
Definition
ubiquitin specific peptidase 17-like D
Orthology
K11845  
ubiquitin carboxyl-terminal hydrolase 17 [EC:3.4.19.12]
Organism
mmu  Mus musculus (mouse)
Brite
Enzymes [BR:mmu01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     384701 (Usp17ld)
Peptidases [BR:mmu01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   384701 (Usp17ld)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
MGI: 
Ensembl: 
Vega: 
UniProt: 
Position
7 E3; 7
AA seq 545 aa AA seqDB search
MVVSLSFPEADPALSSPGAQQLHQDEAQVVVELTANDKPSLSWECPQGPGCGLQNTGNSC
YLNAALQCLTHTPPLADYMLSQEYSQTCCSPEGCKMCAMEAHVTQSLLHSHSGDVMKPSQ
ILTSAFHKHQQEDAHEFLMFTLETMHESCLQVHRQSEPTSEDSSPIHDIFGGLWRSQIKC
LHCQGTSDTYDRFLDVPLDISSAQSVNQALWDTEKSEELRGENAYYCGRCRQKMPASKTL
HIHSAPKVLLLVLKRFSAFMGNKLDRKVSYPEFLDLKPYLSQPTGGPLPYALYAVLVHEG
ATCHSGHYFSYVKAGHGKWYKMDDTKVTSCDVTSVLNENAYVLFYVQQTDLKEVSIDMPE
GRIHEVLDPEYQLKKSRRKKHKKKSPCTEDVGEPSKNREKKATKETSLGEGKVLQEKNHK
KAGQKHENTKLVPQEQNHQKLGQKHRNNEILPQEQNHQKTGQSLRNTEGELDLPADAIVI
HLPRSIANWGRDTPDKVNQPWHNADRLLTSQDLVNTGQLCRQEGRRRSKKGKNKNKQGQK
LLLVR
NT seq 1638 nt NT seq  +upstreamnt  +downstreamnt
atggtggtttctctttccttcccagaagcagatccagccctatcatctcctggtgcccaa
cagctgcatcaggatgaagctcaggtagtggtggagctaactgccaatgacaagcccagt
ctgagttgggaatgtccccaaggaccaggatgcgggcttcagaacacaggcaacagctgc
tacctgaatgcagccctgcagtgcttgacacacacaccacctctagctgactacatgctg
tcccaggagtacagtcaaacctgttgttccccagaaggctgtaagatgtgtgctatggaa
gcccatgtaacccagagtctcctgcactctcactcgggggatgtcatgaagccctcccag
attttgacctctgccttccacaagcaccagcaggaagatgcccatgagtttctcatgttc
accttggaaacaatgcatgaatcctgccttcaagtgcacagacaatcagaacccacctct
gaggacagctcacccattcatgacatatttggaggcttgtggaggtctcagatcaagtgt
ctccattgccagggtacctcagatacatatgatcgcttcctggatgtccccctggatatc
agctcagctcagagtgtaaatcaagccttgtgggatacagagaagtcagaagagctacgt
ggagagaatgcctactactgtggtaggtgtagacagaagatgccagcttccaagaccctg
catattcatagtgccccaaaggtactcctgctagtgttaaagcgcttctcggccttcatg
ggtaacaagttggacagaaaagtaagctacccggagttccttgacctgaagccatacctg
tcccagcctactggaggacctttgccttatgccctctatgctgtcctggtccatgaaggt
gcgacttgtcacagtggacattacttctcttatgtcaaagctggacatgggaagtggtac
aagatggatgatactaaggtcaccagctgcgatgtgacttctgtcctgaatgagaatgcc
tatgtgctcttctatgtgcagcagactgacctcaaagaggtcagtattgacatgccagag
ggcagaatacatgaggttctcgaccctgaataccagctgaagaaatcccggagaaaaaag
cataagaagaaaagcccttgcacagaagatgtgggagagccctccaaaaacagggagaag
aaagcaaccaaagaaacctccttaggggaggggaaagtgcttcaggaaaagaaccacaag
aaagctgggcagaaacacgagaataccaaactcgtgcctcaggaacagaaccaccagaaa
ctggggcagaaacacaggaacaatgaaatcttgcctcaggaacagaaccaccagaaaact
gggcagagcctcaggaacacggaaggtgaacttgatctgcctgctgatgcaattgtgatt
cacctgcccagatccatagcaaattggggcagggatactccagacaaggtgaatcaaccc
tggcacaatgctgacaggctcctcacctctcaggaccttgtgaacactgggcagctctgt
agacaggaaggaagacgaagatcgaagaaggggaagaacaagaacaagcaagggcagaag
cttctgcttgttcgctag

DBGET integrated database retrieval system