KEGG   Mus musculus (mouse): 394430Help
Entry
394430            CDS       T01002                                 

Gene name
Ugt1a10, A13, Ugt1a13
Definition
(RefSeq) UDP glycosyltransferase 1 family, polypeptide A10
  KO
K00699  glucuronosyltransferase [EC:2.4.1.17]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu00040  Pentose and glucuronate interconversions
mmu00053  Ascorbate and aldarate metabolism
mmu00140  Steroid hormone biosynthesis
mmu00830  Retinol metabolism
mmu00860  Porphyrin and chlorophyll metabolism
mmu00980  Metabolism of xenobiotics by cytochrome P450
mmu00982  Drug metabolism - cytochrome P450
mmu00983  Drug metabolism - other enzymes
mmu01100  Metabolic pathways
mmu05204  Chemical carcinogenesis
Module
mmu_M00014  Glucuronate pathway (uronate pathway)
mmu_M00129  Ascorbate biosynthesis, animals, glucose-1P => ascorbate
Brite
KEGG Orthology (KO) [BR:mmu00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    394430 (Ugt1a10)
   00053 Ascorbate and aldarate metabolism
    394430 (Ugt1a10)
  Lipid metabolism
   00140 Steroid hormone biosynthesis
    394430 (Ugt1a10)
  Metabolism of cofactors and vitamins
   00830 Retinol metabolism
    394430 (Ugt1a10)
   00860 Porphyrin and chlorophyll metabolism
    394430 (Ugt1a10)
  Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    394430 (Ugt1a10)
   00982 Drug metabolism - cytochrome P450
    394430 (Ugt1a10)
   00983 Drug metabolism - other enzymes
    394430 (Ugt1a10)
 Human Diseases
  Cancers
   05204 Chemical carcinogenesis
    394430 (Ugt1a10)
Enzymes [BR:mmu01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.17  glucuronosyltransferase
     394430 (Ugt1a10)
Glycosyltransferases [BR:mmu01003]
 Others
  Hydrophobic molecule
   394430 (Ugt1a10)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: UDPGT Glyco_tran_28_C
Motif
Other DBs
NCBI-GeneID: 394430
NCBI-ProteinID: NP_964003
MGI: 3580642
Ensembl: ENSMUSG00000090165
Vega: OTTMUSG00000020817
UniProt: E9PXN7 Q6XL43 Q5FW80
Position
1; 1 D
AA seq 530 aa AA seqDB search
MVPAAFPTSLPLCVCLLLASGLVQAGRLLVVPMDGSHWFDMQMVVEKLIQRGHEVVVVIP
EVSWRLGKSLNCTVKTYSVSHTLEDLDREFKYFTYTQWKTPEQSIRSFMTGSARGFFELM
FSHSRGLFNDKKLVEYLKQRSFDAVFLDPFDVCGLIVAKYLSLPSVIFARLSFCYYLEEG
AQCPSLLSYVPRLFSKYTDTMTFKERVWNHYMYIEDYVFCPYFFKTAVEIASEVLQTPVT
MTDLFSPVSIWLLRTDFVLEFPRPVMPNMVFVGGMNCLQGKPLSKEFEAYVNASGEHGIV
VFSLGSMVSEIPEKKAMEIAEALGRIPQTVLWRYTGTRPSNLAKNTILVKWLPQNDLLGH
PKTRAFITHSGSHGIYEGICNGVPMVMMPLFGDQMDNAKRMETRGAGVTLNVLEMTADDL
ENALKTVINNKSYKENIMRLSSLHKDRPIEPLDLAVFWVEYVMRHKGAPHLRPAAHDLTW
YQYHSLDVIGFLLAIVLTVVFIVFKCCAYGCRKCFGGKGRVKKSHKSKTH
NT seq 1593 nt NT seq  +upstreamnt  +downstreamnt
atggttcctgcagcctttcccacctctcttcctctgtgtgtgtgtctgctcctggcctct
ggcttggtccaggcaggcaggctgctggtggtgcccatggatgggagccactggttcgac
atgcagatggttgtggagaaactcattcagagagggcatgaggttgtggtagtcatccca
gaggtgagttggcggctggggaaatccctgaattgtacagtgaagacttactcggtttct
cacactctggaggacctggacagagagttcaagtattttacttacactcaatggaaaact
ccagaacaaagtatacgttctttcatgacaggctcagctagaggtttctttgaactaatg
ttttcacactctaggggtttgtttaatgacaagaagttagtggagtacttgaagcagaga
tcttttgatgcagtgtttctggatcctttcgatgtatgtggattaattgttgccaagtat
ctgtcactcccatcagtgatctttgcaagactttcattttgctactatcttgaagagggt
gcccagtgcccgagtcttctttcttatgttcctagacttttctcaaaatacacagacacc
atgactttcaaggagagagtgtggaaccattatatgtacattgaagactatgtattttgc
ccctattttttcaaaactgctgttgaaattgcctctgaagttctgcagaccccagtgact
atgacagacctctttagcccagtgtctatttggttgttacgcactgactttgtgttggag
ttccccagacctgtgatgcccaacatggtctttgttggtgggatgaactgtctccagggg
aagccactttccaaggaatttgaagcctatgtcaacgcctctggggagcatggcatcgtt
gttttctctttgggatccatggtctcagagattccggagaagaaagccatggaaattgct
gaggctttgggcagaattcctcagacggtcctgtggcgctacaccggaactagaccatcg
aatcttgcaaagaacacaattcttgtcaaatggctaccccaaaatgatctgcttggtcat
ccaaagactcgggcattcatcacacactctggctcccatggtatttatgaaggaatatgc
aatggagttccgatggtgatgatgcccctatttggcgatcagatggacaatgccaagcgc
atggaaactcggggagctggggtgaccctgaatgtccttgaaatgactgctgatgatttg
gaaaatgcccttaaaactgtcatcaacaacaagagctacaaggagaacatcatgcgcctc
tccagccttcacaaggaccgtcctatagagcctctggacctggctgtgttctgggtggaa
tacgtgatgaggcacaagggggcaccacacctgcgcccggccgcccatgacctcacctgg
tatcagtaccactccttggatgtgattggcttcctcctggccattgtgttgacagtggtc
ttcattgtctttaaatgttgtgcctatggctgccggaaatgctttgggggaaaggggcga
gtgaagaaatcacacaaatccaagacccattga

DBGET integrated database retrieval system