KEGG   Mus musculus (mouse): 394433Help
Entry
394433            CDS       T01002                                 

Gene name
Ugt1a5
Definition
UDP glucuronosyltransferase 1 family, polypeptide A5
Orthology
K00699  
glucuronosyltransferase [EC:2.4.1.17]
Organism
mmu  Mus musculus (mouse)
Pathway
Pentose and glucuronate interconversions
Ascorbate and aldarate metabolism
Steroid hormone biosynthesis
Starch and sucrose metabolism
Retinol metabolism
Porphyrin and chlorophyll metabolism
Metabolism of xenobiotics by cytochrome P450
Drug metabolism - cytochrome P450
Drug metabolism - other enzymes
Metabolic pathways
Chemical carcinogenesis
Module
Glucuronate pathway (uronate pathway)
Ascorbate biosynthesis, animals, glucose-1P => ascorbate
Brite
KEGG Orthology (KO) [BR:mmu00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    394433 (Ugt1a5)
   00053 Ascorbate and aldarate metabolism
    394433 (Ugt1a5)
   00500 Starch and sucrose metabolism
    394433 (Ugt1a5)
  Lipid metabolism
   00140 Steroid hormone biosynthesis
    394433 (Ugt1a5)
  Metabolism of cofactors and vitamins
   00830 Retinol metabolism
    394433 (Ugt1a5)
   00860 Porphyrin and chlorophyll metabolism
    394433 (Ugt1a5)
  Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    394433 (Ugt1a5)
   00982 Drug metabolism - cytochrome P450
    394433 (Ugt1a5)
   00983 Drug metabolism - other enzymes
    394433 (Ugt1a5)
 Human Diseases
  Cancers
   05204 Chemical carcinogenesis
    394433 (Ugt1a5)
Enzymes [BR:mmu01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.17  glucuronosyltransferase
     394433 (Ugt1a5)
Glycosyltransferases [BR:mmu01003]
 Others
  Hydrophobic molecule
   394433 (Ugt1a5)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
MGI: 
UniProt: 
Position
1 D; 1
AA seq 529 aa AA seqDB search
MGLRMPLQGLVGLLLLCALPWTEGEKVLVFPVGGSHWLSMRDVVRELHAQGHQTVVLAPE
VNMRIKEEDFFTFKVYAVPYTRQELEEMMENLKVFFDTGNYMKKIFKTSEALRNMSTVLL
KTCTNILHNESLLHHLNSSSFDVVFTDPVFPCGALLAKYLGIPAVFFLRYIPCGIEYEAT
QCPSPSSYIPNLFTRLSDHMDFLQRVQNMLYHLVLKYICHLLITPYESLASELFQREVSS
VELFSYASVWLFRGDFVLDYPRPIMPNMVFIGGINCVTKKPLSQEFEAYVNASGEHGIVV
FSLGSMVSEIPEKKAMEIAEALGRIPQTVLWRYTGTRPSNLAKNTILVKWLPQNDLLGHP
KTRAFITHSGSHGIYEGICNGVPMVMMPLFGDQMDNAKRMETRGAGVTLNVLEMTADDLE
NALKTVINNKSYKENIMRLSSLHKDRPIEPLDLAVFWVEYVMRHKGAPHLRPAAHDLTWY
QYHSLDVIGFLLAIVLTVVFIVFKCCAYGCRKCFGGKGRVKKSHKSKTH
NT seq 1590 nt NT seq  +upstreamnt  +downstreamnt
atgggactccgcatgcccctacaaggattagtggggctgctcctgctgtgtgccctgcct
tggactgaaggtgagaaggtgctagtgtttcctgtggggggaagccactggctgagcatg
agggatgttgtgagagagctccacgcccaaggtcaccagactgtggtcctggctccagag
gtgaacatgcgcatcaaagaagaggactttttcactttcaaagtctatgccgttccctat
acaagacaagaattggaagaaatgatggaaaaccttaaagtgttttttgacacaggaaac
tatatgaagaaaatctttaaaacatctgaggctttgagaaacatgtcaaccgttctctta
aagacttgtacaaatatattgcacaacgagtccctgctccaccacctgaattccagctcc
tttgatgtagtctttacagatcccgtgtttccctgtggggcattgttggccaagtactta
ggtattcctgctgtgttctttctacgatacatcccctgtggcatagaatatgaggccaca
cagtgtccaagcccttcctcttatattccgaacctattcacaaggctttccgaccacatg
gacttcctgcaaagggtccagaacatgctgtaccatctggtcttgaagtacatttgccat
ttattgatcactccctatgaaagcctggcctctgagctttttcagagagaagtgtcctca
gtggagcttttcagctatgcatccgtgtggctgttccgaggggactttgtactcgactac
cccaggcccatcatgcctaacatggtcttcattgggggcataaactgtgttaccaagaag
cccctctctcaggaatttgaagcctatgtcaacgcctctggggagcatggcatcgttgtt
ttctctttgggatccatggtctcagagattccggagaagaaagccatggaaattgctgag
gctttgggcagaattcctcagacggtcctgtggcgctacaccggaactagaccatcgaat
cttgcaaagaacacaattcttgtcaaatggctaccccaaaatgatctgcttggtcatcca
aagactcgggcattcatcacacactctggctcccatggtatttatgaaggaatatgcaat
ggagttccgatggtgatgatgcccctatttggcgatcagatggacaatgccaagcgcatg
gaaactcggggagctggggtgaccctgaatgtccttgaaatgactgctgatgatttggaa
aatgcccttaaaactgtcatcaacaacaagagctacaaggagaacatcatgcgcctctcc
agccttcacaaggaccgtcctatagagcctctggacctggctgtgttctgggtggaatac
gtgatgaggcacaagggggcaccacacctgcgcccggccgcccatgacctcacctggtat
cagtaccactccttggatgtgattggcttcctcctggccattgtgttgacagtggtcttc
attgtctttaaatgttgtgcctatggctgccggaaatgctttgggggaaaggggcgagtg
aagaaatcacacaaatccaagacccattga

DBGET integrated database retrieval system