KEGG   Mus musculus (mouse): 394435Help
Entry
394435            CDS       T01002                                 

Gene name
Ugt1a6b, A9', Ugt1a9
Definition
UDP glucuronosyltransferase 1 family, polypeptide A6B
Orthology
K00699  
glucuronosyltransferase [EC:2.4.1.17]
Organism
mmu  Mus musculus (mouse)
Pathway
Pentose and glucuronate interconversions
Ascorbate and aldarate metabolism
Steroid hormone biosynthesis
Starch and sucrose metabolism
Retinol metabolism
Porphyrin and chlorophyll metabolism
Metabolism of xenobiotics by cytochrome P450
Drug metabolism - cytochrome P450
Drug metabolism - other enzymes
Metabolic pathways
Chemical carcinogenesis
Module
Glucuronate pathway (uronate pathway)
Ascorbate biosynthesis, animals, glucose-1P => ascorbate
Brite
KEGG Orthology (KO) [BR:mmu00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    394435 (Ugt1a6b)
   00053 Ascorbate and aldarate metabolism
    394435 (Ugt1a6b)
   00500 Starch and sucrose metabolism
    394435 (Ugt1a6b)
  Lipid metabolism
   00140 Steroid hormone biosynthesis
    394435 (Ugt1a6b)
  Metabolism of cofactors and vitamins
   00830 Retinol metabolism
    394435 (Ugt1a6b)
   00860 Porphyrin and chlorophyll metabolism
    394435 (Ugt1a6b)
  Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    394435 (Ugt1a6b)
   00982 Drug metabolism - cytochrome P450
    394435 (Ugt1a6b)
   00983 Drug metabolism - other enzymes
    394435 (Ugt1a6b)
 Human Diseases
  Cancers
   05204 Chemical carcinogenesis
    394435 (Ugt1a6b)
Enzymes [BR:mmu01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.17  glucuronosyltransferase
     394435 (Ugt1a6b)
Glycosyltransferases [BR:mmu01003]
 Others
  Hydrophobic molecule
   394435 (Ugt1a6b)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
MGI: 
Ensembl: 
Vega: 
UniProt: 
Position
1 D; 1
AA seq 531 aa AA seqDB search
MACLLPAAQTLPAGFLFLVLWASVLGDKLLVVPQDGSHWLSMKEIVEHLSERGHDIVVLV
PEVNLLLGESKYYRRKIFSVPYSLEELQTRFRTFGRNQFVPGAPLMGPLREYRNSMLTLE
MFFSNCQSLLKDSATLSFLRENKFDALFTDPAMPCGVILAEYLNLPSVYLFRGFPCSLEH
MLGQSPSPVSYVPRFYTKFSDHMTFPQRLANFIVNILENYLYYCLYSKYEIIVTDLLKRD
VSLPSLHQNSLWLLRYDFVFEYPRPIMPNMIFIGGINCKKKGKLTQEFEAYVNASGEHGI
VVFSLGSMVSEIPEKKAMEIAEALGRIPQTVLWRYTGTRPSNLAKNTILVKWLPQNDLLG
HPKTRAFITHSGSHGIYEGICNGVPMVMMPLFGDQMDNAKRMETRGAGVTLNVLEMTADD
LENALKTVINNKSYKENIMRLSSLHKDRPIEPLDLAVFWVEYVMRHKGAPHLRPAAHDLT
WYQYHSLDVIGFLLAIVLTVVFIVFKCCAYGCRKCFGGKGRVKKSHKSKTH
NT seq 1596 nt NT seq  +upstreamnt  +downstreamnt
atggcttgccttcttcctgctgctcagacacttcctgcagggtttctcttcctagtgctt
tgggcctcagttctaggtgacaagctgctggtggtcccccaggatggaagccactggctt
agcatgaaggagatagtggagcatctcagtgaacgaggacatgacattgtggtcctagtg
ccagaagtcaatttgcttttgggagaatccaaatactacaggaggaaaattttctcagtt
ccctacagcctagaagaactacagacccgttttcgcacctttggacgcaaccagtttgtt
cctggtgcccccctgatgggtcctctaagagagtacaggaacagcatgcttacattggag
atgttcttttccaactgccagagcctcctgaaggactctgccaccctcagcttcctcagg
gagaacaagtttgatgctctgttcacagacccagccatgccctgtggtgtgatcctggct
gagtatctcaacctgccctctgtctacctcttcagaggtttcccatgctctctggaacac
atgcttggtcaaagcccaagccctgtgtcctatgtgcccagattctacaccaaattctca
gaccacatgacatttccccaacggctggccaacttcattgttaacatcttggaaaactac
ctatattattgtctgtattcaaagtatgaaatcattgtcacagacctcctcaagagagat
gtgtccctaccttccttacaccagaattctctgtggctgttacggtacgattttgtgttc
gaatatcccaggccaatcatgcccaacatgatcttcattggagggatcaactgtaagaag
aagggaaagctgactcaggaatttgaagcctatgtcaacgcctctggggagcatggcatc
gttgttttctctttgggatccatggtctcagagattccggagaagaaagccatggaaatt
gctgaggctttgggcagaattcctcagacggtcctgtggcgctacaccggaactagacca
tcgaatcttgcaaagaacacaattcttgtcaaatggctaccccaaaatgatctgcttggt
catccaaagactcgggcattcatcacacactctggctcccatggtatttatgaaggaata
tgcaatggagttccgatggtgatgatgcccctatttggcgatcagatggacaatgccaag
cgcatggaaactcggggagctggggtgaccctgaatgtccttgaaatgactgctgatgat
ttggaaaatgcccttaaaactgtcatcaacaacaagagctacaaggagaacatcatgcgc
ctctccagccttcacaaggaccgtcctatagagcctctggacctggctgtgttctgggtg
gaatacgtgatgaggcacaagggggcaccacacctgcgcccggccgcccatgacctcacc
tggtatcagtaccactccttggatgtgattggcttcctcctggccattgtgttgacagtg
gtcttcattgtctttaaatgttgtgcctatggctgccggaaatgctttgggggaaagggg
cgagtgaagaaatcacacaaatccaagacccattga

DBGET integrated database retrieval system