KEGG   Mus musculus (mouse): 399510Help
Entry
399510            CDS       T01002                                 

Gene name
Map4k5, 4432415E19Rik, GCKR, KHS, MAPKKKK5
Definition
(RefSeq) mitogen-activated protein kinase kinase kinase kinase 5 (EC:2.7.11.1)
  KO
K08833  
mitogen-activated protein kinase kinase kinase kinase 5 [EC:2.7.11.1]
Organism
mmu  Mus musculus (mouse)
Brite
Enzymes [BR:mmu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     399510 (Map4k5)
Protein kinases [BR:mmu01001]
 Serine/threonine protein kinases: STE group
  STE20 family
   399510 (Map4k5)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
MGI: 
Ensembl: 
Vega: 
UniProt: 
Position
12; 12 C3
AA seq 847 aa AA seqDB search
MEAPLRPAADILRRNPQHDYELVQRVGSGTYGDVYKARNVHTGELAAVKIIKLEPGDDFS
LIQQEIFMVKECKHCNIVAYFGSYLSREKLWICMEYCGGGSLQDIYHVTGPLSEMQIAYV
CRETLQGLAYLHTKGKMHRDIKGANILLTDHGDVKLADFGVAAKITATIAKRKSFIGTPY
WMAPEVAAVEKNGGYNQLCDIWAVGITAIELGELQPPMFDLHPMRALFLMSKSNFQPPKL
KDKTKWSSTFHNFVKIALTKNPKKRPTAERLLTHTFVGQPGLSRALAVELLDKVSNPDNH
APYSEGDEDDLEPHAIIRHTIRSTNRNSRAERTASEINFDKLQFEPPLRKETEARDEMGL
SSEPNFILHWNPFVDGANTGRSTSKRAIPPPLPPKPRVNTYPEDSLPDEEKSSTIKRCPD
LEARAPQVLRRQSSPSCVPVAETSSSIGNGDGISKLISENTEGSAQAPQLPRKKDKRDFP
KPTINGLPPTPKVLMGACFSKVFDGCPLKINCATSWIHPDTKDQYIIFGTEDGIYTLNLN
ELHEATMEQLFPRKCTWLYVINNTLMSLSEGKTFQLYSHNLIALFEQAKKPGLAAHIQTH
RFPDRILPRKFALTTKIPDTKGCHKCCIVRNPYTGHKYLCGALQSGIVLLQWYEPMQKFM
LIKHFDFPLPSPLNVFEMLVIPEQEYPMVCVAISKGSDSSQVVQFETINLNSASSWFTEI
GAGSQQLDSIHVTQLERDTVLVCLDKFVKIVNLQGKLKSSKKLASELSFDFRIESVVCLQ
DSVLAFWKHGMQGKSFKSDEVTQEISDETRVFRLLGSDRVVVLESRPTENPAAHSNLYIL
AGHENSY
NT seq 2544 nt NT seq  +upstreamnt  +downstreamnt
atggaggccccgctgaggcctgccgccgacatcctgagacggaacccgcagcacgactac
gagctggtgcagagggtcggcagcggcacctacggggacgtgtacaaggccagaaatgta
catacaggagaattagctgcagtaaagatcatcaagttggagcctggtgatgatttttct
ttgattcagcaagagatatttatggttaaagaatgtaagcattgcaacatcgtagcctac
tttgggagctatctcagtagggagaagctgtggatttgcatggagtactgcggtggcgga
tcacttcaagatatctatcacgtgactgggccattatctgaaatgcaaatagcctacgtc
tgcagagagaccttacagggtcttgcctacttgcatactaaaggcaaaatgcatagagat
atcaaaggtgcaaatatcttattaacagaccatggtgatgtaaaattagctgattttggt
gtggctgcaaaaattacagctaccattgcaaagaggaagtccttcatcggcaccccttac
tggatggctccagaagttgcagcagtggaaaagaatggtggctacaaccaactctgtgat
atctgggccgtcggaataacagcaatcgagctgggagaactgcagccgcctatgtttgac
ctgcatccaatgagggctctcttcttaatgtcaaaaagtaatttccagcctccaaagcta
aaggacaaaactaaatggtcatcgacattccataattttgtcaaaatagcactaactaaa
aaccccaagaaaagaccaactgctgaaaggcttctgactcacacttttgttgggcagcca
ggcctgtctcgggcgctcgcggttgagctgttggacaaggtgagcaatccggacaaccat
gctccctacagtgagggcgatgaggacgacttggagccccacgcaatcattcgtcatacc
attagatcaacaaacaggaattccagagcggagcggacagcttcagaaataaactttgac
aaattacaatttgaacctcctctgagaaaagaaacagaagcccgggatgaaatgggatta
tcatcagagccaaactttatattacattggaatccttttgtggatggagcaaatacaggc
agatcaacctctaagcgtgcaataccacctccgctacctcctaagccgagggtcaacact
taccctgaagacagcctcccagatgaagaaaaatcatcaaccatcaaacgttgccctgat
ctggaggcgagagcacctcaggtcctcagaagacagagtagcccaagttgtgttcctgtg
gcggagacatcctcctctataggaaatggtgatggtatttcaaaactgatcagtgaaaat
acagagggatccgcacaagctccgcagttacctcggaaaaaggacaagcgggacttcccc
aaaccaaccatcaatggccttccacccaccccaaaagtactgatgggagcatgtttttca
aaagtatttgatggctgccctttgaaaattaattgtgcaacatcctggatacaccctgat
acaaaagatcagtatattatttttggaactgaagatggtatttacacattgaatctcaat
gagctacatgaagcaactatggaacagttatttccacggaaatgtacgtggctctacgtc
atcaataatacactgatgtcattatcagaaggaaaaacctttcagctctactctcacaac
cttattgctttgtttgaacaagccaaaaaaccagggttagccgcccacatccaaactcac
aggtttcctgaccgcattctgccaagaaaatttgccttaacaactaagattcccgataca
aaaggctgccacaaatgctgcatagttagaaacccttacacgggacataagtacctctgt
ggagctttgcagtctggcatcgttctgcttcagtggtatgagccgatgcagaaattcatg
ctgataaagcatttcgattttcctttaccaagtccactgaatgtttttgaaatgctggtg
atcccagagcaggagtaccccatggtttgtgtggctatcagcaaaggctcggactccagc
caagtagttcagtttgagacaatcaacttgaattctgcatcttcctggtttacagaaatt
ggtgcaggcagccaacagctggattccattcatgtgacacagttggagagagatactgtt
ttggtgtgtttagacaaatttgtaaaaattgtaaatctacaaggaaagctgaagtccagt
aagaagctggcatctgagctcagttttgacttccgcattgagtctgtggtgtgccttcaa
gacagcgtgttggctttctggaaacacgggatgcagggtaaaagcttcaaatcagatgag
gttacccaggaaatttcagatgagaccagggttttccgcctgctgggatcagacagggtg
gtggttttggaaagccggccaacagaaaaccctgcagcacacagcaatctctacatcctg
gctggacatgaaaacagttactaa

DBGET integrated database retrieval system