KEGG   Mus musculus (mouse): 404195Help
Entry
404195            CDS       T01002                                 

Gene name
Cyp2c54, EG404195
Definition
cytochrome P450, family 2, subfamily c, polypeptide 54 (EC:1.14.14.1)
Orthology
K07413  
cytochrome P450, family 2, subfamily C [EC:1.14.14.1]
Organism
mmu  Mus musculus (mouse)
Pathway
Steroid hormone biosynthesis
Arachidonic acid metabolism
Linoleic acid metabolism
Retinol metabolism
Metabolic pathways
Serotonergic synapse
Inflammatory mediator regulation of TRP channels
Chemical carcinogenesis
Brite
KEGG Orthology (KO) [BR:mmu00001]
 Metabolism
  Lipid metabolism
   00140 Steroid hormone biosynthesis
    404195 (Cyp2c54)
   00590 Arachidonic acid metabolism
    404195 (Cyp2c54)
   00591 Linoleic acid metabolism
    404195 (Cyp2c54)
  Metabolism of cofactors and vitamins
   00830 Retinol metabolism
    404195 (Cyp2c54)
 Organismal Systems
  Nervous system
   04726 Serotonergic synapse
    404195 (Cyp2c54)
  Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    404195 (Cyp2c54)
 Human Diseases
  Cancers
   05204 Chemical carcinogenesis
    404195 (Cyp2c54)
Enzymes [BR:mmu01000]
 1. Oxidoreductases
  1.14  Acting on paired donors with incorporation of molecular oxygen
   1.14.14  With reduced flavin or flavoprotein as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.14.1  unspecific monooxygenase
     404195 (Cyp2c54)
Cytochrome P450 [BR:mmu00199]
 Cytochrome P450, animal type
  CYP2 family
   404195 (Cyp2c54)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
MGI: 
Ensembl: 
UniProt: 
Position
19 C3; 19
AA seq 490 aa AA seqDB search
MDPILVLVLTLSCLFLLSLWRQSYERGKLPPGPTPLPIIGNILQIDVKDICQSFTNLSRV
YGPVYTLYLGRKPTVVLHGYEAVKEALVDHGDVFAGRGRLPVFDKATNGMGIGFSNGSVW
KNTRHFSLMTLRNLGMGKRSIEDRVQEEARCLVEELRKTNGSPCDPTFILGCAPCNVICS
IIFQDRFDYKDRDFLNLLEKLDEISKILSTPWLQVCNTFPALLDYCPGSHNQFFKNYAYI
KNFLLEKIREHKESLDVTIPRDFIDYFLIKGAQEDDNHPLKNNFEHLAITVTDLFIGGTE
SMSTTLRYALLLLLKYPHVTAKVQEEIEHVIGKHRRPCMQDRSHMPYTNAMIHEVQRFID
LVPNNLPHEVTCDIKFRNYFIPKGTTVITSLSSVLRDSKEFPNPEKFDPGHFLDENGKFK
KSDYFMPFSTGKRICAGEGLARMELFLFLTSILQNFNLKPLVHPKDIDITPMLIGLGSVP
PAFQLCFIPS
NT seq 1473 nt NT seq  +upstreamnt  +downstreamnt
atggatccaatcctggtcctggtgctcactctctcctgtctgtttctcctctcactctgg
agacagagctatgaaagagggaagcttccccctggccccactcctcttccaattattgga
aacatccttcagatagatgtgaaggacatctgccaatccttcaccaatttatcaagagtt
tatggtcctgtgtatactctatatttgggcaggaagcccactgtggtgttgcatggatat
gaggcagtgaaggaagctctggttgaccatggggatgtctttgctggaaggggaaggctc
ccagtttttgataaagctactaatggaatgggcattggatttagtaatggaagtgtatgg
aaaaacacgaggcacttctcactcatgactctgcggaatttaggcatgggaaaaaggagc
attgaggaccgtgttcaagaggaagcacgttgccttgtggaggaacttaggaaaaccaat
ggctcaccctgtgatcccaccttcatcctgggctgtgctccctgcaatgtcatctgctca
attattttccaggatcgttttgattataaagatcgggattttctaaacttgttggaaaaa
ctggatgaaatatccaagattctgagcaccccctggttgcaggtttgcaatacatttcct
gctctgcttgattattgtccaggaagtcataaccaattttttaaaaattatgcttatatt
aaaaatttccttttggagaaaataagggaacataaagaatcattggatgttacaattcct
cgggactttattgattatttcctaattaaaggagcccaggaagatgacaatcatcctttg
aaaaataattttgaacacctggcaataacagtgactgatctttttattggtgggacagag
tcaatgagcacaacactgagatatgctctcctactcctattgaagtacccacatgtcaca
gctaaagtccaggaagaaattgagcatgtgatcggcaagcaccgaagaccatgcatgcag
gacaggagccacatgccctatacaaatgccatgattcatgaggtccagagattcattgac
cttgtccccaacaacctgccccatgaagtgacctgtgacattaaattcaggaactacttc
attcccaagggaacaactgtaataacatcactgtcatcagtgctgcgtgatagcaaggag
ttccccaacccagagaagtttgaccctgggcactttctagatgagaatggaaagtttaaa
aaaagtgactacttcatgccattctcaacagggaaacggatatgtgcaggagagggcctg
gcacgcatggagctgttcctgttcctaaccagcattttacagaacttcaacctgaaacct
ctggttcacccaaaggacatagatataaccccaatgctcattggattgggctcagtgcct
cctgctttccagctctgcttcattccttcctga

DBGET integrated database retrieval system