KEGG   Mus musculus (mouse): 436059Help
Entry
436059            CDS       T01002                                 

Gene name
Ces2h, Ces2, EG436059, Gm5744
Definition
carboxylesterase 2H (EC:3.1.1.1)
Orthology
K03927  
carboxylesterase 2 [EC:3.1.1.1 3.1.1.84 3.1.1.56]
Organism
mmu  Mus musculus (mouse)
Pathway
Drug metabolism - other enzymes
Brite
KEGG Orthology (KO) [BR:mmu00001]
 Metabolism
  Xenobiotics biodegradation and metabolism
   00983 Drug metabolism - other enzymes
    436059 (Ces2h)
Enzymes [BR:mmu01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.1  carboxylesterase
     436059 (Ces2h)
    3.1.1.56  methylumbelliferyl-acetate deacetylase
     436059 (Ces2h)
    3.1.1.84  cocaine esterase
     436059 (Ces2h)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
MGI: 
Ensembl: 
UniProt: 
Position
8 D3; 8
AA seq 558 aa AA seqDB search
MRLEQIHARLTTATCGLLLLLRVQGQDSTSPIRTTHTGQILGSLIHMKDLDVGVHSFLGI
PFAKPPVGPLRFAPPEPPEPWGGVRDGTSHPAMCLQDITAMNMQAFKLLKLTLPPFPMSE
DCLYLNIYAPDHAHEGSNLPVMVWIHGGSLVIGMASMYDGSMLAAMENVVVVTIQYRLGV
LGFFSTGDERARGNWGYLDQVAALRWLQQNIAYFGGNPDRVTIFGTSAGGTSVSSLVVSP
MSQGLFRGAIMESGVALISSLISVSSDVVYQTVANLSGCEQVDSEALVNCLRGKSEEEIM
AINKAFKIIPGIVDGIFLPRHPQELMASADFHPVPSIIGVNNDEYGWIIPSSMSMIDSKK
GMDRQMVQAILQRRATQMMWPPEVSDLLMEEYMGDNEDPQFLQVQFKEMMKDFTFVIPAL
QVAQFQRSHAPVFFYEFQHRPSFFKDSKPSHVKADHGDEILFIFRSFWGGTQVDFTEEEE
LLSRRMMKYWANFARQRNPNSEGLPYWPMFDQDEQYLQLDTQPAVGRALKTRRLQFWTKT
LPEKIQELKDIEDRHKEL
NT seq 1677 nt NT seq  +upstreamnt  +downstreamnt
atgagactggaacaaattcatgctcggctaaccaccgcgacctgtgggctcctgcttctc
ctccgggtccagggccaggactcaaccagtcccatcaggaccacacacacaggccagata
ctgggcagccttatccatatgaaggaccttgatgtgggtgtccactctttcctgggaatc
ccctttgccaagcctcctgtaggaccactgcgctttgcaccccctgagccacctgaacca
tggggtggtgtgagagatgggacatcacatccggccatgtgtctgcaggacatcactgca
atgaatatgcaggcttttaagctgttgaagctgaccttgcctcccttccctatgtctgag
gactgcctataccttaacatctatgcaccagatcatgcccatgagggttccaacctgcct
gtgatggtgtggatccacggtggctcactggttataggcatggcttccatgtatgatgga
tccatgctagcagccatggagaatgtagtagtggtcactatccagtaccgcctaggtgtt
ctgggcttctttagcactggagatgagcgcgccagaggcaactggggatacctggaccaa
gtggccgccctacgctggctccaacagaacatcgcctactttggaggcaaccctgaccgg
gtcactatttttggcacatcagcaggtggcacaagtgtctcttcacttgtggtatcccct
atgtcccaaggacttttccgtggtgccataatggagagtggggtggccctgatatcaagc
ctcatctcagtatcctctgatgtagtctatcaaacggtggccaacctctctggatgtgaa
caggtggactctgaggccctggtgaactgtctacgaggcaaaagcgaggaagagattatg
gctattaataaggccttcaagatcatccctggcatagtggatggtatcttcctgcccaga
catcctcaggagctgatggcctctgctgactttcaccctgttcccagtattatcggtgtc
aacaatgatgagtatggttggatcatcccctcaagcatgagcatgattgactccaagaag
gggatggacagacaaatggtgcaagctatcctgcagagaagggcaacccagatgatgtgg
cctcctgaagtaagtgacctgctgatggaggagtacatgggggacaatgaggaccctcag
tttctccaagtgcagttcaaggagatgatgaaagatttcacctttgtgatccctgcactg
caagtcgcacagtttcaacgttcccatgcccctgtcttcttctatgagttccagcatcgg
cccagcttcttcaaggactccaagccatcccatgtaaaggctgaccatggtgatgaaatt
ctctttatcttcagatcattttggggaggcacccaagttgacttcactgaggaggaagag
ctgctgagcaggaggatgatgaagtactgggccaacttcgcacgacagaggaaccccaac
agtgagggtctaccctactggcccatgtttgaccaagatgagcagtacctgcagctggac
acccagcctgctgtgggtcgagctctgaagacccgaaggctgcagttctggaccaagact
cttcctgaaaagatacaggaactaaaagatattgaggacagacataaagagttgtag

DBGET integrated database retrieval system