KEGG   Mus musculus (mouse): 50498Help
Entry
50498             CDS       T01002                                 

Gene name
Ebi3, EBI-3, IL-27
Definition
Epstein-Barr virus induced gene 3
Organism
mmu  Mus musculus (mouse)
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
MGI: 
Ensembl: 
UniProt: 
Position
17 D; 17 29.08 cM
AA seq 228 aa AA seqDB search
MSKLLFLSLALWASRSPGYTETALVALSQPRVQCHASRYPVAVDCSWTPLQAPNSTRSTS
FIATYRLGVATQQQSQPCLQRSPQASRCTIPDVHLFSTVPYMLNVTAVHPGGASSSLLAF
VAERIIKPDPPEGVRLRTAGQRLQVLWHPPASWPFPDIFSLKYRLRYRRRGASHFRQVGP
IEATTFTLRNSKPHAKYCIQVSAQDLTDYGKPSDWSLPGQVESAPHKP
NT seq 687 nt NT seq  +upstreamnt  +downstreamnt
atgtccaagctgctcttcctgtcacttgccctctgggccagccgctcccctggttacact
gaaacagctctcgtggctctaagccagcccagagtgcaatgccatgcttctcggtatccc
gtggccgtggactgctcctggactcctctccaggctcccaactccaccagatccacgtcc
ttcattgccacttacaggctcggtgtggccacccagcagcagagccagccctgcctacaa
cggagcccccaggcctcccgatgcaccatccccgacgtgcacctgttctccacggtgccc
tacatgctaaatgtcactgcagtgcacccaggcggcgccagcagcagcctcctagccttt
gtggctgagcgaatcatcaagccggaccctccggaaggcgtgcgcctgcgcacagcggga
cagcgcctgcaggtgctctggcatccccctgcttcctggcccttcccggacatcttctct
ctcaagtaccgactccgctaccggcgccgaggagcctctcacttccgccaggtgggaccc
attgaagccacgactttcaccctcaggaactcgaaaccccatgccaagtattgcatccag
gtgtcagctcaggacctcacagattatgggaaaccaagtgactggagcctccctgggcaa
gtagaaagtgcaccccataagccctga

DBGET integrated database retrieval system