KEGG   Mus musculus (mouse): 50523Help
Entry
50523             CDS       T01002                                 

Gene name
Lats2, 4932411G09Rik, AV277261, AW228608
Definition
(RefSeq) large tumor suppressor 2 (EC:2.7.11.1)
  KO
K08791  
serine/threonine-protein kinase LATS1/2 [EC:2.7.11.1]
Organism
mmu  Mus musculus (mouse)
Pathway
Hippo signaling pathway
Hippo signaling pathway -multiple species
Module
Hippo signaling
Brite
KEGG Orthology (KO) [BR:mmu00001]
 Environmental Information Processing
  Signal transduction
   04390 Hippo signaling pathway
    50523 (Lats2)
   04392 Hippo signaling pathway - multiple species
    50523 (Lats2)
Enzymes [BR:mmu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     50523 (Lats2)
Protein kinases [BR:mmu01001]
 Serine/threonine protein kinases: AGC group
  NDR family
   50523 (Lats2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
MGI: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
14; 14 C3
AA seq 1042 aa AA seqDB search
MRPKTFPATTYSGNSRQRLQEIREGLKQPSKASTQGLLVGPNSDTSLDAKVLGSKDASRQ
QQMRATPKFGPYQKALREIRYSLLPFANESGTSAAAEVNRQMLQELVNAGCDQEMAGRAL
KQTGSRSIEAALEYISKMGYLDPRNEQIVRVIKQTSPGKGLAPTPVTRRPSFEGTGEALP
SYHQLGGANYEGPAALEEMPRQYLDFLFPGAGAGTHGAQAHQHPPKGYSTAVEPSAHFPG
THYGRGHLLSEQPGYGVQRSSSFQNKTPPDAYSSMAKAQGGPPASLTFPAHAGLYTASHH
KPAATPPGAHPLHVLGTRGPTFTGESSAQAVLAPSRNSLNADLYELGSTVPWSAAPLARR
DSLQKQGLEASRPHVAFRAGPSRTNSFNNPQPEPSLPAPNTVTAVTAAHILHPVKSVRVL
RPEPQTAVGPSHPAWVAAPTAPATESLETKEGSAGPHPLDVDYGGSERRCPPPPYPKHLL
LPSKSEQYSVDLDSLCTSVQQSLRGGTEQDRSDKSHKGAKGDKAGRDKKQIQTSPVPVRK
NSRDEEKRESRIKSYSPYAFKFFMEQHVENVIKTYQQKVSRRLQLEQEMAKAGLCEAEQE
QMRKILYQKESNYNRLKRAKMDKSMFVKIKTLGIGAFGEVCLACKLDTHALYAMKTLRKK
DVLNRNQVAHVKAERDILAEADNEWVVKLYYSFQDKDSLYFVMDYIPGGDMMSLLIRMEV
FPEHLARFYIAELTLAIESVHKMGFIHRDIKPDNILIDLDGHIKLTDFGLCTGFRWTHNS
KYYQKGNHMRQDSMEPGDLWDDVSNCRCGDRLKTLEQRAQKQHQRCLAHSLVGTPNYIAP
EVLLRKGYTQLCDWWSVGVILFEMLVGQPPFLAPTPTETQLKVINWESTLHIPTQVRLSA
EARDLITKLCCAADCRLGRDGADDLKAHPFFNTIDFSRDIRKQPAPYVPTISHPMDTSNF
DPVDEESPWHEASGESAKAWDTLASPSSKHPEHAFYEFTFRRFFDDNGYPFRCPKPSEPA
ESADPGDADLEGAAEGCQPVYV
NT seq 3129 nt NT seq  +upstreamnt  +downstreamnt
atgaggccaaagacttttcctgccacaacttactctggaaatagccggcagcgattgcaa
gagattcgagaggggctgaagcagccatccaaggcttccacccaggggctgctggtggga
ccaaacagtgacacttccctggatgccaaagtcctggggagcaaagatgcctccaggcag
cagcaaatgagagccaccccgaagtttggaccttatcaaaaagctctcagggaaatccga
tattccctcctgccttttgccaacgagtcaggcacttcggcagctgcagaggtgaaccgg
cagatgcttcaggagttggtgaatgcgggatgtgaccaggagatggctggcagagcgctc
aagcagacgggcagtaggagtatcgaagctgccttggagtacatcagtaagatgggctac
ctggaccccaggaatgagcagattgtgcgagtcatcaagcagacctccccaggaaagggc
ctggcgcccaccccggtgactcggcggcccagtttcgagggcacaggggaagcactccca
tcctaccaccagctgggtggtgcaaactacgagggccccgccgcactggaggagatgccg
cggcaatatttagactttctcttccctggagccggagccggcacccacggtgcccaggct
caccagcatcctcccaaagggtacagcacagcagtagagccaagtgcgcactttccgggc
acacactatggtcgtggtcatctactatcggagcagcctgggtatggggtgcagcgcagt
tcctccttccagaacaagacgccaccagatgcctattccagcatggccaaggcccagggt
ggccctcccgccagcctcacctttcctgcccatgctgggctgtacactgcctcgcaccac
aagccggcggctaccccacctggggcccacccattacatgtgttgggcacccggggtccc
acgtttactggcgaaagctctgcacaggctgtgctggcaccgtccaggaacagcctcaat
gctgacttgtacgagctgggctccacggtgccctggtctgcagctccactggcacgccgc
gactcgctgcagaagcagggtctagaagcctcgcggccgcatgtggcttttcgggctggc
cccagcaggaccaactccttcaacaacccacaacctgagccctcactgcccgcccccaac
acggtcaccgccgtgacggccgcacacatccttcaccctgtgaagagcgtgcgtgtgctg
cggcccgagccccagacagccgtggggccctcgcaccccgcctgggtggctgcgcccaca
gcacctgccactgagagcctggagacgaaggagggcagcgcaggcccacacccgctggat
gtggactatggcggctccgagcgcaggtgcccaccgcctccgtacccaaagcacttgctg
ctgcccagtaagtctgagcagtacagcgtggacctggacagcctgtgcaccagtgtgcag
cagagtctgcgagggggcactgagcaagacaggagtgacaagagccacaaaggtgcgaag
ggagacaaagctggcagagacaaaaagcagattcagacctccccggtgcctgtccgcaag
aatagcagagatgaagagaagagagagtctcgcatcaagagttactccccttatgccttc
aaattcttcatggagcaacacgtggagaatgtcatcaaaacctaccagcagaaggtcagc
cggaggctacagctggagcaggaaatggccaaagctgggctctgtgaggccgagcaggag
cagatgaggaagatcctctaccagaaggagtctaactacaaccggctgaagagggccaag
atggacaagtccatgtttgtgaaaatcaagactctaggcatcggtgcctttggggaagtg
tgcctcgcttgtaagctggacactcacgctctgtacgccatgaagactctcaggaagaag
gatgtcctgaaccggaatcaagtggcccatgtcaaggctgagagggacatcctggctgaa
gcagacaatgagtgggtggtcaaactctactactccttccaggacaaggacagcctgtac
tttgtgatggactacataccaggcggggatatgatgagcctgctgatcaggatggaggtc
ttccctgagcacctggcccgcttctacattgcagagttgaccctggccattgaaagtgtc
cacaagatgggctttatccaccgggacatcaagcctgacaacatactcatcgacctggat
ggtcatattaagctgacagattttggcctctgcactggattcaggtggactcacaattcc
aagtactaccagaaagggaaccacatgagacaggacagcatggagcccggtgacctctgg
gacgatgtttccaactgtcgctgtggagacaggttaaagaccctggagcagagggcgcag
aagcagcaccagaggtgcctggcacattctcttgtcgggacaccaaattacatcgctccg
gaggtgcttctccgcaaagggtacacgcagctctgtgactggtggagcgtcggtgtgatt
ctctttgagatgctggttgggcagccgcctttcttggcccccacccccacagagacgcag
ctgaaggtgatcaactgggagagcacgctgcatatccctacgcaggtgaggctcagcgct
gaggcccgagacctcatcacgaagctgtgctgcgcggctgactgccgcctgggcagggat
ggggcagatgacctcaaggcacacccgttcttcaacaccatcgacttttcccgtgacatc
cgaaagcagcctgcaccctacgtccccaccatcagccaccccatggacacctccaatttt
gacccggtggatgaagaaagcccctggcacgaggccagcggagagagcgccaaggcctgg
gacacgctggcctcccccagcagcaagcatccagagcacgccttctatgagttcaccttc
cgcaggttcttcgatgacaacggctatcccttccggtgcccgaagccctcagagcccgca
gagagtgcagacccaggggatgcggacttggaaggtgcggccgagggctgccagccggtg
tacgtgtaa

DBGET integrated database retrieval system