KEGG   Mus musculus (mouse): 50721Help
Entry
50721             CDS       T01002                                 

Gene name
Sirt6, 2810449N18Rik, AI043036, Sir2l6
Definition
sirtuin 6 (EC:2.4.2.31)
Orthology
K11416  
mono-ADP-ribosyltransferase sirtuin 6 [EC:2.4.2.31]
Organism
mmu  Mus musculus (mouse)
Brite
Enzymes [BR:mmu01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.31  NAD+---protein-arginine ADP-ribosyltransferase
     50721 (Sirt6)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
MGI: 
Ensembl: 
Vega: 
UniProt: 
Position
10 C1; 10 39.72 cM
AA seq 294 aa AA seqDB search
MWQSSSVVFHTGAGISTASGIPDFRGPHGVWTMEERGLAPKFDTTFENARPSKTHMALVQ
LERMGFLSFLVSQNVDGLHVRSGFPRDKLAELHGNMFVEECPKCKTQYVRDTVVGTMGLK
ATGRLCTVAKTRGLRACRGELRDTILDWEDSLPDRDLMLADEASRTADLSVTLGTSLQIR
PSGNLPLATKRRGGRLVIVNLQPTKHDRQADLRIHGYVDEVMCRLMKHLGLEIPAWDGPC
VLDKALPPLPRPVALKAEPPVHLNGAVHVSYKSKPNSPILHRPPKRVKTEAAPS
NT seq 885 nt NT seq  +upstreamnt  +downstreamnt
atgtggcagtcctccagcgtggttttccacacgggcgccggcatcagcaccgcctctggc
atccccgacttcagaggcccccatggcgtgtggaccatggaggaacgcggcctggccccc
aagtttgacaccaccttcgagaatgctcggccctcgaagacccacatggccctggttcag
ctagaacgcatgggcttcctcagcttcctggtcagccagaacgtagacgggctgcacgtg
cgctcgggcttccccagggacaagctggcagagctgcacggaaacatgtttgtagaggaa
tgtcccaagtgtaagacgcagtacgtcagagacacggttgtgggcaccatgggcctcaag
gccacaggccggctctgcaccgtggccaagaccaggggacttcgggcctgtagaggggag
ctgagagacaccattctggactgggaggactcgttgcctgaccgggacctgatgctcgct
gatgaggccagcaggaccgcagacctgtctgtcaccctgggtacctcgctgcagatccgc
cccagtgggaacctgccccttgccactaagcgccgaggaggccgtctggtcattgtcaac
ctgcaacccacaaaacatgaccgccaggctgacctgcgcatccacggctacgtggatgag
gtgatgtgcagactcatgaagcatctggggctggagattccagcctgggatggaccctgc
gtgctagacaaagccctgccacctctgcctcgcccagtagcactcaaggctgagcccccc
gtgcatctcaatggtgcagtgcatgtttcgtataagtccaagcccaacagccctatactc
cacaggccccccaaaagagtgaagaccgaggctgcccccagctga

DBGET integrated database retrieval system