KEGG   Mus musculus (mouse): 50767Help
Entry
50767             CDS       T01002                                 

Gene name
Pnpla6, AI661849, MSws, Nte
Definition
patatin-like phospholipase domain containing 6 (EC:3.1.1.5)
Orthology
K14676  
lysophospholipid hydrolase [EC:3.1.1.5]
Organism
mmu  Mus musculus (mouse)
Pathway
Glycerophospholipid metabolism
Brite
KEGG Orthology (KO) [BR:mmu00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    50767 (Pnpla6)
Enzymes [BR:mmu01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.5  lysophospholipase
     50767 (Pnpla6)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
MGI: 
Ensembl: 
UniProt: 
Position
8 A1.1; 8 1.92 cM
AA seq 1345 aa AA seqDB search
MEESLQPKDCRLQDLLPSPKQSMEAPLQTGMVLGVMIGAGVAVLVTAVLILLVVRRLRVQ
KTPAPEGPRYRFRKRDKVLFYGRKIMRKVSQSTSSLVDTSVSTTSRPRMKKKLKMLNIAK
KILRIQKETPTLQRKEPPPSVLEADLTEGDLANSHLPSEVLYMLKNVRVLGHFEKPLFLE
LCRHMVFQRLGQGDYVFRPGQPDASIYVVQDGLLELCLPGPDGKECVVKEVVPGDSVNSL
LSILDVITGHQHPQRTVSARAARDSTVLRLPVEAFSAVFTKYPESLVRVVQIIMVRLQRV
TFLALHNYLGLTNELFSHEIQPLRLFPSPGLPTRTSPVRGSKRVVSTSGTEDTSKETSGR
PLDSIGAPLPGPAGDPVKPTSLEAPPAPLLSRCISMPVDISGLQGGPRSDFDMAYERGRI
SVSLQEEASGGPQTASPRELREQPAGACEYSYCEDESATGGCPFGPYQGRQTSSIFEAAK
RELAKLMRIEDPSLLNSRVLLHHAKAGTIIARQGDQDVSLHFVLWGCLHVYQRMIDKAEE
VCLFVAQPGELVGQLAVLTGEPLIFTLRAQRDCTFLRISKSHFYEIMRAQPSVVLSAAHT
VAARMSPFVRQMDFAIDWTAVEAGRALYRQGDRSDCTYIVLNGRLRSVIQRGSGKKELVG
EYGRGDLIGVVEALTRQPRATTVHAVRDTELAKLPEGTLGHIKRRYPQVVTRLIHLLSQK
ILGNLQQLQGPFPGSGLSVPQHSELTNPASNLSTVAILPVCAEVPMMAFTLELQHALQAI
GPTLLLNSDVIRALLGASALDSIQEFRLSGWLAQQEDAHRIVLYQTDTSLTPWTVRCLRQ
ADCILIVGLGDQEPTVGQLEQMLENTAVRALKQLVLLHREEGPGPTRTVEWLNMRSWCSG
HLHLRCPRRLFSRRSPAKLHELYEKVFSRRADRHSDFSRLARVLTGNTIALVLGGGGARG
CSHIGVLKALEEAGVPVDLVGGTSIGSFIGALYAEERSASRTKQRAREWAKSMTSVLEPV
LDLTYPVTSMFTGSAFNRSIHRVFQDKQIEDLWLPYFNVTTDITASAMRVHKDGSLWRYV
RASMTLSGYLPPLCDPKDGHLLMDGGYINNLPADIARSMGAKTVIAIDVGSQDETDLSTY
GDSLSGWWLLWKRLNPWADKVKVPDMAEIQSRLAYVSCVRQLEVVKSSSYCEYLRPSIDC
FKTMDFGKFDQIYDVGYQYGKAVFGGWTRGEVIEKMLTDRRSTDLNESRRADILAFPSSG
FTDLAEIVSRIEPPTSYVSDGCADGEESDCLTEYEEDAGPDCSRDEGGSPEGASPSTASE
VEEEKSTLRQRRFLPQETPSSVADA
NT seq 4038 nt NT seq  +upstreamnt  +downstreamnt
atggaggagtcactccagccaaaggactgcaggctacaagacctgctacctagtccgaaa
caatcgatggaggccccactgcaaaccggaatggtgctgggcgtgatgatcggggccgga
gtggcggtgctggtcaccgccgtgctcatcctcttggtggtgcgaaggctgcgggtgcag
aaaactccagccccggagggtccccggtatcggttccggaagcgggacaaagtgcttttc
tatggccggaagattatgcggaaggtgtcacagtccacttcttccctggtggacacatca
gtctccaccacttcccggccccgcatgaagaagaaactgaagatgcttaacattgccaag
aagatcttacgtatccaaaaggagactccgaccctacaacggaaggagcccccaccttca
gtgctggaggctgacctcacagagggagacctggccaattcccacctaccctctgaggta
ctctacatgcttaagaatgttcgggtgctaggtcactttgagaagccgctcttcctggag
ctctgccggcacatggtcttccagcgtctcgggcagggggactatgtttttcggcccggt
caaccagatgccagcatctatgtggttcaagatgggctgctggagctctgcctaccaggg
cctgatgggaaggagtgtgtggtgaaggaggtggttcctggagacagcgtcaacagcctt
ctgagcatccttgatgtcatcacgggtcaccagcatccccagcggactgtgtcagccagg
gctgcacgggactccacagtgctgagactcccagtagaagccttctctgctgtcttcacc
aagtaccctgagagtttggtgcgagtggtacagatcatcatggtaaggctgcagagagtc
accttcctggcgcttcacaattacctgggtctgaccaatgaactcttcagtcatgagatc
cagcccctacgccttttccccagccccggcctcccgacccgaaccagccctgtccgtggc
tctaaacgggtagtcagcacctcaggtactgaggacacctcaaaggagacctctggccgg
cccctggactccattggagctcctctgcctggacctgcaggggatcccgtgaagcccaca
tccttagaagcacccccagccccgttactgagccgctgcatctccatgccagtagacatc
tcaggcttgcaaggtggccctcgttctgattttgacatggcctatgaacgtggacggata
tctgtttctcttcaagaagaggcatctgggggacctcagacagcatcccctagggagctc
cgggagcagccagcgggtgcctgtgaatatagctactgtgaggatgagtcagccacaggc
ggatgtccctttgggccctaccagggccgccagacaagcagcatctttgaggctgcaaag
agagagctagccaagctgatgcggattgaggacccctctctactgaacagcagagtcttg
ctacatcatgccaaagccggcaccatcatagcccgccaaggggaccaggatgtgagcctg
cactttgtgctctggggctgcctgcacgtgtaccagcgcatgattgacaaggctgaggaa
gtgtgcctatttgtggcacagccaggggagctggtggggcaactggcggtgctcactggg
gaacctctcatcttcacactacgtgcccagagagactgcaccttcctgcggatctccaaa
tcccacttctatgagatcatgcgtgcacaacccagtgtggtactgagtgcagctcacacg
gtggctgctagaatgtcccccttcgtgcgccagatggactttgccattgactggacagct
gtggaggctggtcgtgcgctctacaggcagggagaccgctccgactgcacctacattgta
ctcaatggacgtctccgtagtgtcatccaacgaggcagtggcaagaaggagctagttggg
gagtatggtcgaggggatctcattggcgtggtggaggcactgacccggcagccacgagcc
accactgtacacgcagtgcgagacactgagctggccaagcttcccgagggcaccttaggc
cacatcaaacgtcggtacccacaggttgtgacccgccttattcatctgctaagccagaaa
attctaggcaatctgcagcagttgcaaggaccctttccaggctccgggctcagtgttccg
cagcactcggaactgaccaacccagccagcaatctgtctactgtagctatcctccctgtg
tgtgctgaggtgcccatgatggcctttactctggaactgcagcatgctctgcaagctatt
ggtcccacgctcctccttaacagtgacgtcatccgggcactcctgggggcttcagcactg
gatagcattcaagaattccggctgtcagggtggttggcccagcaggaagatgcccatcgc
attgtgctctaccaaactgacacatccctgacgccttggaccgtccgttgtctgcgccag
gccgactgcatcctcattgtgggcctgggggaccaggaacccactgttggccagctggag
caaatgttagagaacactgctgtccgtgccttgaagcaactggttttgctgcaccgggag
gaaggccctggtcccacgcgcactgtagagtggctcaacatgcgcagctggtgctcaggg
cacctgcacctgcgctgtcctcgccgcctcttctcacggcgcagcccagcgaaacttcat
gagctgtatgagaaggttttctccaggcgtgcagaccgtcacagcgacttctcccgcttg
gcacgagtactcacaggaaacactattgctctggtgctgggtgggggcggagccagaggc
tgctcgcatattggggtgctgaaggcattagaggaggcaggagtcccagtcgaccttgtg
ggaggcacatccataggttccttcattggggccttgtatgccgaggaacgcagcgccagc
cgaactaaacaacgagcccgggagtgggccaagagcatgacttctgtactggagcctgta
ttggacctcacatatcctgtcacctccatgtttactggctcagcctttaacagaagtatc
caccgtgtcttccaggataagcagattgaggacctgtggctgccttacttcaatgtgacc
acagacatcactgcctctgccatgcgcgtccacaaagatggctccctgtggcggtatgta
cgtgccagcatgacgctctcgggctacctacccccgctgtgcgacccaaaggatgggcac
ctgctcatggatggtggctacatcaacaacctgccagcggatattgcccgaagcatggga
gccaaaacggtcattgccatcgacgttggaagccaggatgagacagatctcagcacctat
ggggacagcctgtctggctggtggttgctgtggaaaaggctaaacccctgggcagacaag
gtaaaggttccagacatggctgagatccagtcccgcttggcgtacgtgtcctgtgtgcgg
cagctagaagtcgtcaagtccagctcctattgcgagtaccttcgtccatccattgactgc
ttcaagaccatggactttggaaagtttgaccagatctatgatgtgggttaccagtatggg
aaggctgtctttggaggctggacccgtggtgaagtcattgagaaaatgctcacagaccgg
agatctacagaccttaatgagagtcgccgtgcagatatacttgccttcccaagttctggg
ttcactgacttggctgagattgtgtcccggatcgagccaccaacaagctacgtctctgat
ggctgtgctgatggggaggagtcggattgcttgacagagtatgaggaagatgcaggacca
gactgctcaagagatgaagggggctcccctgagggtgccagccctagcactgcctcagag
gtggaagaagagaagtccacactccggcaacgacgctttctgcctcaggagactcccagc
tcagtcgcagatgcctga

DBGET integrated database retrieval system