KEGG   Mus musculus (mouse): 50778Help
Entry
50778             CDS       T01002                                 

Gene name
Rgs1, BL34
Definition
(RefSeq) regulator of G-protein signaling 1
  KO
K16449  
regulator of G-protein signaling
Organism
mmu  Mus musculus (mouse)
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
MGI: 
Ensembl: 
Vega: 
UniProt: 
Position
1 F; 1 62.56 cM
AA seq 209 aa AA seqDB search
MRAAAISMPRLNKMPGMFFSASPKDSKEHSHSLLDDKKQKKRPKTFGMDVKTYLRSMIPH
LESGMKSAKSKDILSAEEVMQWSQSLEKLLANQTGQNVFGRFLKSEFSEENIEFWLACED
YKKTETDLLHNKAENIYKAFVHSDAVKQINIDFHTRESTAKKIKTPTPTSFDEAQKVIYS
LMEKDSYPRFLKSNIYLNLLNDLQANTLK
NT seq 630 nt NT seq  +upstreamnt  +downstreamnt
atgagagcggcagccatctccatgccaaggttgaacaaaatgccaggaatgttcttttct
gctagcccaaaggattcgaaagaacacagccattctcttctagacgacaaaaagcagaaa
aaaaggccaaagacttttggaatggacgtgaaaacatacctgagatcgatgatcccacat
ctggaatctgggatgaaatcggccaagtccaaagacatactttctgctgaagaagtaatg
cagtggtctcagtctctggaaaaactccttgccaaccagacaggtcaaaatgtctttgga
agatttctaaagtctgaattcagtgaggaaaatattgaattctggttggcttgtgaggac
tataagaaaacagagactgatcttttgcataacaaagcagagaatatatacaaagcattt
gtgcattcagatgctgtgaaacaaatcaatattgacttccatactcgagaatcgacagcc
aagaagattaaaacaccaactcccacatcttttgatgaagcacaaaaagtcatatattca
ctcatggaaaaagattcttatcccaggttcctgaaatcaaatatttacttaaatcttcta
aatgaccttcaggcaaatactttaaagtga

DBGET integrated database retrieval system