KEGG   Mus musculus (mouse): 51789Help
Entry
51789             CDS       T01002                                 

Gene name
Tnk2, Ack, Ack-1, Ack1, Cdgip, Pyk1
Definition
(RefSeq) tyrosine kinase, non-receptor, 2 (EC:2.7.11.1 2.7.10.2)
  KO
K08886  
activated CDC42 kinase 1 [EC:2.7.10.2 2.7.11.1]
Organism
mmu  Mus musculus (mouse)
Brite
Enzymes [BR:mmu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.2  non-specific protein-tyrosine kinase
     51789 (Tnk2)
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     51789 (Tnk2)
Protein kinases [BR:mmu01001]
 Tyrosine protein kinases
  Ack family
   51789 (Tnk2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
MGI: 
Ensembl: 
Vega: 
UniProt: 
Position
16; 16 B3
AA seq 1055 aa AA seqDB search
MQPEEGTGWLLELLSEVQLQQYFLRLRDDLNITRLSHFEYVKNEDLEKIGMGRPGQRRLW
EAVKRRKAMCKRKSWMSKVFSGKRLEAEFPSQHSQSTFRKPSPTPGSLPGEGTLQSLTCL
IGEKDLRLLEKLGDGSFGVVRRGEWDAPAGKTVSVAVKCLKPDVLSQPEAMDDFIREVNA
MHSLDHRNLIRLYGVVLTLPMKMVTELAPLGSLLDRLRKHQGHFLLGTLSRYAVQVAEGM
AYLESKRFIHRDLAARNLLLATRDLVKIGDFGLMRALPQNDDHYVMQEHRKVPFAWCAPE
SLKTRTFSHASDTWMFGVTLWEMFTYGQEPWIGLNGSQILHKIDKEGERLPRPEDCPQDI
YNVMVQCWAHKPEDRPTFVALRDFLLEAQPTDMRALQDFEEPDKLHIQMNDVITVIEGRA
ENYWWRGQNTRTLCVGPFPRNVVTSVAGLSAQDISQPLQNSFIHTGHGDSDPRHCWGFPD
RIDELYLGNPMDPPDLLSVELSTSRPTQHLGRVKREPPPRPPQPAIFTQKPTYDPVSEDP
DPLSSDFKRLGLRKPALPRGLWLAKPSARVPGTKADRSSGGEVTLIDFGEEPVVPTPRPC
APSLAQLAMDACSLLDKTPPQSPTRALPRPLHPTPVVDWDARPLPPPPAYDDVAQDEDDF
EVCSINSTLVGAGLPAGPSQGETNYAFVPEQAQMPPALEDNLFLPPQGGGKPPSSVQTAE
IFQALQQECMRQLQVPTGQLTPSPTPGGDDKPQVPPRVPIPPRPTRPRVELSPAPSGEEE
TSRWPGPASPPRVPPREPLSPQGSRTPSPLVPPGSSPLPHRLSSSPGKTMPTTQSFASDP
KYATPQVIQAPGPRAGPCILPIVRDGRKVSSTHYYLLPERPPYLERYQRFLREAQSPEEP
AALPVPPLLPPPSTPAPAAPTATVRPMPQAAPDPKANFSTNNSNPGARPPSLRATARLPQ
RGCPGDGQEAARPADKVQMLQAMVHGVTTEECQAALQSHSWSVQRAAQYLKVEQLFGLGL
RPRVECHKVLEMFDWNLEQAGCHLLGSCGPAHHKR
NT seq 3168 nt NT seq  +upstreamnt  +downstreamnt
atgcagccggaggagggaacgggctggctgttggagctgctgtccgaggtgcagctacaa
cagtatttcctgaggcttcgagatgacctcaacattacccgcctatctcattttgaatat
gtcaaaaatgaagacctggaaaagattggcatgggccggcctggccagaggcggctgtgg
gaggccgtgaagaggaggaaggccatgtgcaaacgcaagtcatggatgagcaaggtgttc
agtggaaagcggttggaggccgagttcccttcccagcactctcagagcaccttccggaag
ccctcccccaccccagggagcctgccaggggaggggaccctgcagagcctcacctgcctc
attggggagaaagacctacgcctgctggagaagctgggggatggctcctttggcgtggtg
cgcaggggtgaatgggacgcccccgcagggaagacggtgagtgtggccgtcaagtgcctg
aagcctgacgtgctgagccagccagaggccatggacgacttcatccgggaggtcaatgcc
atgcattcactagaccaccgaaacctcattcgcttgtatggtgtggtgctcacactaccc
atgaagatggtgacagagctggcacctctgggatctttgttggaccgcctacgtaaacac
caaggtcatttcctcttggggacgctgagtcgctacgctgtgcaggtggctgagggtatg
gcctacctggagtccaagcgcttcattcaccgggatctggctgctcgaaacctgcttttg
gctacccgggacctggtcaagattggggacttcggactgatgcgagctctgccccagaat
gatgaccactatgtcatgcaagaacaccgcaaggtgccctttgcctggtgtgcccctgag
agcctgaagacacggactttctcccatgccagtgacacctggatgtttggggtcacactg
tgggagatgttcacctatggccaggagccctggattggcctcaatggcagccagatcctg
cataagatcgacaaggaaggggagcgcctgccccggccggaggactgccctcaagacatc
tacaatgtcatggtccagtgctgggcccacaagccagaggacagacccacatttgtggct
cttcgggacttcctgctggaggctcagcccactgacatgcgggctcttcaggactttgag
gagccagataaactgcacatccagatgaatgacgtcatcactgtcatcgagggaagggct
gagaactactggtggcgtgggcagaatacgcggaccctgtgtgtaggacccttccctcga
aatgtcgtgacctccgtggctggcctgtcagcccaggacatcagccagcctctacagaat
agcttcattcacacaggacatggtgacagtgacccccgccactgctgggggttccctgac
aggatcgatgaactgtacctgggaaaccccatggaccctcctgacctgctgagtgtggaa
ctgagcacctcccgacccacccagcacctaggacgggtgaaaagggagcctccacctcgc
ccacctcagcctgccatcttcactcagaagccaacatacgaccctgtgagtgaggaccca
gaccccctgtccagcgacttcaagaggcttggcctgaggaagccagccctgcctcgaggg
ctgtggctggcaaagccctcagcccgagtgccaggcaccaaggcagaccgcagcagtggg
ggtgaggtcacactcatcgacttcggtgaggagcctgtggtcccaacccctcggccctgt
gcaccctccttggcacagttggccatggatgcctgctccttgctggacaagacaccacca
cagagccccacacgggcactgccacgacctttacaccccacccctgtggtagactgggac
gcgcgtccgctgcccccgccccctgcctatgacgacgtggcccaggatgaggatgacttt
gaggtctgctccatcaacagcacgctagtaggtgcaggcctccctgctgggcctagccaa
ggcgagaccaattacgcctttgtacctgagcaggcgcagatgccccctgccctggaggat
aacctgttccttccaccccagggcggaggcaagccgcccagctcagtgcagactgcagag
attttccaggcactgcagcaggagtgtatgcggcagctacaggtccccactggccagctg
accccctccccgaccccaggaggtgatgacaagccccaggtgccaccccgggtacctatt
ccccctcggcccacgcgtccacgtgtggagctatctccagctccctcgggtgaggaagag
acaagccggtggcctggacctgcctcgcccccccgagtgcctccccgggaacctctgtct
cctcaaggttcaaggaccccaagccccctagtgccacctggcagctctccactaccgcat
cggctctctagctcacctggaaagaccatgcccaccactcaaagctttgcctcagaccct
aagtatgccactccacaagtgatccaggctcctggcccacgggcaggcccctgcatcctg
cccattgtccgcgatggcaggaaggtcagcagcactcattactacctgctgcctgagcgc
cctccttacctggaacgctatcagcgcttcctgcgggaggcccagagcccggaagagccg
gccgccctgcctgtgcccccgctgttgcccccgcccagtactccagcccctgctgccccc
actgccaccgtcagacctatgcctcaggccgccccagacccaaaggccaacttctccacc
aataacagcaacccaggggcacggccaccatccctgagggccacggctcggctgccacag
aggggctgcccaggggacgggcaagaggctgctcggccagcagacaaggtccagatgctg
caggccatggtgcatggggtgaccacagaggagtgccaggcggccctgcagagccacagc
tggagtgttcagagggctgcccagtatctgaaggtggagcagctctttgggctgggtctt
cggccacgggtggagtgccacaaggtcctagagatgttcgactggaacctagagcaagcc
ggctgtcaccttctgggctcctgtggccctgctcatcacaaacgctga

DBGET integrated database retrieval system