KEGG   Mus musculus (mouse): 52033Help
Entry
52033             CDS       T01002                                 

Gene name
Pbk, 2810434B10Rik, AW538537, D14Ertd732e, TOPK
Definition
PDZ binding kinase (EC:2.7.12.2)
Orthology
K08865  
PDZ-binding kinase [EC:2.7.12.2]
Organism
mmu  Mus musculus (mouse)
Brite
Enzymes [BR:mmu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.12  Dual-specificity kinases (those acting on Ser/Thr and Tyr residues)
    2.7.12.2  mitogen-activated protein kinase kinase
     52033 (Pbk)
Protein kinases [BR:mmu01001]
 Serine/threonine protein kinases: Other group
  TOPK family
   52033 (Pbk)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
MGI: 
Ensembl: 
Vega: 
UniProt: 
Position
14 D1; 14 34.36 cM
AA seq 330 aa AA seqDB search
MEGINNFKTPNKSEKRKSVLCSTPCVNIPASPFMQKLGFGTGVSVYLMKRSPRGLSHSPW
AVKKISLLCDDHYRTVYQKRLTDEAKILKNLNHPNIIGYRAFTEASDGSLCLAMEYGGEK
SLNDLIEERNKDSGSPFPAAVILRVALHMARGLKYLHQEKKLLHGDIKSSNVVIKGDFET
IKICDVGVSLPLDENMTVTDPEACYIGTEPWKPKEALEENGIITDKADVFAFGLTLWEMM
TLCIPHVNLPDDDVDEDATFDESDFDDEAYYAALGTRPSINMEELDDSYQKAIELFCVCT
NEDPKDRPSAAHIVEALELDGQCCGLSSKH
NT seq 993 nt NT seq  +upstreamnt  +downstreamnt
atggaaggaattaataatttcaagacgccaaacaaatctgaaaaaaggaaatctgtatta
tgttccactccatgtgtaaatatccctgcctctccatttatgcagaagcttggctttggg
actggggtcagcgtttacctaatgaaaagatctccaagagggttgtctcattctccttgg
gccgtgaaaaagataagtcttttatgcgatgatcattatcgaactgtgtatcagaagaga
ctaactgatgaagctaagattttaaaaaaccttaatcacccaaacattataggatatcgt
gcttttactgaagccagtgatggtagtctgtgccttgctatggagtatggaggtgaaaag
tctctgaatgacttaatagaagagcggaacaaagacagtggaagtccttttccagcagct
gtaattctcagagttgctttgcacatggccagagggctaaagtacctgcaccaagaaaag
aagctgcttcatggagacataaagtcttcaaatgttgtaattaaaggtgattttgaaaca
attaaaatctgtgatgtaggagtctctctgccattggatgaaaatatgactgtgactgat
cctgaggcctgttatattggtactgagccatggaaacccaaggaagcgttggaagaaaat
ggcatcattactgacaaggcagatgtgtttgcttttggccttactctgtgggaaatgatg
actttatgtattccacacgtcaatcttccagatgatgatgttgatgaagatgcaaccttt
gatgagagtgacttcgatgatgaagcatattatgcagctctggggacaaggccatccatc
aacatggaagagctggatgactcctaccagaaggccattgaactcttctgtgtgtgcact
aatgaggatcctaaagatcgcccgtctgctgcacacatcgttgaagctttggaactagat
ggccaatgttgtggtctaagctcaaagcattaa

DBGET integrated database retrieval system