KEGG   Mus musculus (mouse): 52076Help
Entry
52076             CDS       T01002                                 

Gene name
Tmem38b, 1600017F22Rik, AA437809, AV051057, D4Ertd89e, TRIC-B, mg33b
Definition
(RefSeq) transmembrane protein 38B
Organism
mmu  Mus musculus (mouse)
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
MGI: 
Ensembl: 
Vega: 
UniProt: 
Position
4 B2; 4 28.76 cM
AA seq 292 aa AA seqDB search
MEYPWDDLTLAFSRTSMFPFFDIAHYLVSVMALKQRPGAVAAAWNNPLASWLSAMLHCFG
GGILSCMLLAESPLKFLTNHTNILLASSIWYIVFFCPRDLVSQGYSYQPIQFLAAGMKEV
TRTWKIVGGVSDANSYYRNAWIVMIVVGWARGAGGAVVTACEQLLKGDWKPEGDEWLKMS
FPCKITLLGSIMFTFQHTRHLAISKHDLMFLYTIFLVTIKVTMMMTKDTAVTLTPFEDTL
TRMLFGRRQQQQFSSSEKKTEVKPSSNGSASSASKRGAEPSGGAKRHAKKED
NT seq 879 nt NT seq  +upstreamnt  +downstreamnt
atggagtacccgtgggatgatctgactctggccttttcccgcacgtccatgtttcccttt
tttgatatcgcccactacctggtgtcggtgatggcgctgaagcagcggccaggagcagtg
gcggcggcctggaataaccccctggctagctggctgagtgccatgctccattgctttggt
ggaggaattttatcctgtatgctgcttgcagagtctccattgaagtttcttacaaaccac
actaatattttactggcatcttcaatctggtatattgtattcttttgccctcgtgaccta
gtttcccagggttattcatatcaacctattcagttcctggctgcgggaatgaaggaagtg
acccggacgtggaaaatagtaggcggagtctcggatgctaatagctattacagaaatgcc
tggatagtcatgatagttgttggatgggcccgaggtgcaggtggtgctgtcgtcacagct
tgtgaacagttgttaaaaggagactggaaaccagaaggtgatgaatggctgaagatgtcc
ttcccttgcaagataaccctgctggggtcaattatgttcaccttccagcacaccaggcac
ctggcgatctcaaagcatgatctcatgttcctttacactatcttcctcgtgaccataaag
gtaaccatgatgatgacaaaggatactgctgtgactctcactccctttgaggacaccctg
actcggatgctttttggccggcggcagcagcagcagttttcatcgagtgaaaagaaaact
gaagtcaaaccgtcttccaatggttctgcctcaagtgcatcgaagcggggagcagagcct
tcgggtggtgctaagagacacgccaagaaagaagactga

DBGET integrated database retrieval system