KEGG   Mus musculus (mouse): 52276Help
Entry
52276             CDS       T01002                                 

Gene name
Cdca8, 4831429J16Rik, AU044747, BOR, Borealin, D4Ertd421e, DasraB, MESRGP
Definition
(RefSeq) cell division cycle associated 8
  KO
K11514  
Borealin
Organism
mmu  Mus musculus (mouse)
Brite
Chromosome [BR:mmu03036]
 Eukaryotic Type
  Centromeric chromatin formation proteins
   Kinetochore proteins
    CPC (chromosomal passenger complex)
     52276 (Cdca8)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
MGI: 
Ensembl: 
Vega: 
UniProt: 
Position
4 D2.2; 4 57.93 cM
AA seq 289 aa AA seqDB search
MAPKKRSSRGTRTNTLRSRKLASFLKDFDREVQVRTKQIESDRQTLLKEVENLYNIEILR
LPKALQGMKWLDYFALGGNKQALEEAAKADRDITEINNLTAEAIQTPLKSVKKRKVIEVE
ESIKEEEEEEEEGGGGGGRTKKSHKNLRSAKVKRCLPSKKRTQSIQGRGRSKRLSHDFVT
PAMSRLEPSLVKPTPGMTPRFDSRVFKTPGLRTPAAKEQVYNISINGSPLADSKEISLSV
PIGGGASLRLLASDLQRIDIAQLNPEALGNIRKLSSRLAQICSSIRTGR
NT seq 870 nt NT seq  +upstreamnt  +downstreamnt
atggctcccaagaaacgcagcagccgcggaaccaggaccaacacgctgcggagccggaag
ctcgcctccttcctgaaggacttcgaccgcgaggtgcaagttcgaaccaagcaaattgag
tccgacagacagaccctcctcaaggaggtggaaaatctgtacaacatcgagatccttcgg
ctccccaaggcgctgcaagggatgaagtggcttgactacttcgccctaggaggaaacaag
caggccctggaagaggcagcaaaagctgatcgagacatcacagaaataaacaatttaaca
gctgaagctattcagacacctttgaaatctgttaaaaagcgaaaggtaatcgaggtggag
gaatcgataaaggaagaagaagaagaggaagaagaaggaggaggaggaggaggaagaaca
aaaaagagccataagaatcttcgatctgcaaaagtcaaaagatgccttccatccaagaag
agaacccagtccatacaaggaagaggcagaagtaaaaggttaagccatgactttgtgacg
ccagctatgagcaggctggagccgtctctggtgaaaccaaccccaggcatgacacctagg
tttgactcccgggtcttcaagactccagggctacgcactccagcagccaaagagcaagtt
tacaacatctccatcaacggcagccctctcgcagacagcaaagagatctccctcagtgtg
cccataggtggcggtgcgagcttgcggttattggccagtgacttgcaaaggattgatatt
gctcagctgaatccagaggctctgggaaacattagaaagctctcgagccgcctcgcccag
atctgcagcagcatacggacgggccgatga

DBGET integrated database retrieval system