KEGG   Mus musculus (mouse): 52615Help
Entry
52615             CDS       T01002                                 

Gene name
Suz12, 2610028O16Rik, AI195385, AU016842, AW536442, D11Ertd530e, mKIAA0160
Definition
(RefSeq) suppressor of zeste 12 homolog (Drosophila)
  KO
K11463  
polycomb protein SUZ12
Organism
mmu  Mus musculus (mouse)
Brite
Chromosome [BR:mmu03036]
 Eukaryotic Type
  Histone modification proteins
   Polycomb group proteins
    PRC2-EZH1 complex
     52615 (Suz12)
    PRC2-EZH2 complex
     52615 (Suz12)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
MGI: 
Ensembl: 
Vega: 
UniProt: 
Position
11 B5; 11 47.36 cM
AA seq 741 aa AA seqDB search
MAPQKHGGGGGGGSGPSAGSGGGGFGGSAAAVAAAASGGKSGGGGCGGGGSYSASSSSAA
AAAAAAGAAVLPVKKPKMEHVQADHELFLQAFEKPTQIYRFLRTRNLIAPIFLHRTLTYM
SHRNSRTSIKRKTFKVDDMLSKVEKMKGEQESHSLSAHLQLTFTGFFHKNDKPSQNSENE
QNSVTLEVLLVKVCHKKRKDVSCPIRQVPTGKKQVPLNPDLNQTKPGNFPSLAVSSNEFE
PSNSHMVKSYSLLFRVTRPGRREFNGMINGETNENIDVSEELPARRKRNREDGEKTFVAQ
MTVFDKNRRLQLLDGEYEVAMQEMEECPISKKRATWETILDGKRLPPFETFSQGPTLQFT
LRWTGETNDKSTAPVAKPLATRNSESLHQENKPGSVKPAQTIAVKETLTTELQTRKEKDN
SNESRQKLRIFYQFLYNNNTRQQTEARDDLHCPWCTLNCRKLYSLLKHLKLCHSRFIFNY
VYHPKGARIDVSINECYDGSYAGNPQDIHRQPGFAFSRNGPVKRTPITHILVCRPKRTKA
SMSEFLESEDGEVEQQRTYSSGHNRLYFHSDTCLPLRPQEMEVDSEDEKDPEWLREKTIT
QIEEFSDVNEGEKEVMKLWNLHVMKHGFIADNQMNHACMLFVENYGQKIIKKNLCRNFML
HLVSMHDFNLISIMSIDKAVTKLREMQQKLEKGESATPSNEEIAEEQNGTANGFSETNSK
EKALETDGVSGVPKQSKKQKL
NT seq 2226 nt NT seq  +upstreamnt  +downstreamnt
atggcgcctcagaagcacggcggtgggggagggggcggctcggggcccagcgcggggtcc
gggggaggcggcttcgggggttcggcggcggcggtggcggcggcggcttcgggcggcaaa
tccggcggcgggggctgtggaggcggcggcagttactcggcctcctcctcctcggcggcg
gccgcggcggcggcggcgggggccgcggtgttgccggtgaagaagccgaaaatggagcac
gtccaggctgaccacgagcttttcctccaggcctttgagaaaccaacacagatatataga
tttcttcgaactcgaaatcttatcgcaccaatatttttgcacagaactcttacttacatg
tctcatcgaaattccagaacaagcatcaaaaggaaaacatttaaagttgatgatatgtta
tcaaaagtagagaaaatgaaaggagagcaagaatctcatagcttgtctgcacatttgcaa
cttacatttaccggtttcttccacaaaaatgataagccatcacaaaactcagaaaatgaa
caaaattctgttaccctggaagtcctgcttgtgaaagtttgccacaaaaaaaggaaggat
gtaagttgtccaataagacaagtccctactggtaaaaagcaggtgcctttgaatcctgac
ctcaatcaaacaaaaccaggaaattttccatccctggcagtttccagtaatgaatttgaa
cctagtaacagccatatggtgaagtcctactcgttgctgtttagagtaactcgtccagga
agaagagaatttaatggaatgattaatggagaaaccaatgaaaatattgatgtcagtgaa
gaacttccagccagaagaaaacgaaatcgcgaagatggagaaaagacatttgttgcacaa
atgacagtttttgacaaaaacaggcgtttacagcttttagatggggaatatgaagtggcc
atgcaggaaatggaagaatgtccaataagtaagaaaagagcaacatgggagacaattctt
gatgggaagaggctgcctccatttgagacattttctcagggacctacattacaatttact
cttcgatggacaggagaaaccaacgataagtctacagctcctgttgccaagcctcttgcc
actagaaattcagagagccttcatcaggaaaataagcctggttctgttaaacctgcacaa
actattgctgttaaggagacgctgactacagagctgcaaacaagaaaagaaaaggataat
tcaaatgaaagtcgccagaagttaagaatattttatcagttcctttataacaataataca
agacaacagacagaagccagagacgacctgcactgcccgtggtgcactctgaactgccgt
aaactgtatagcttactcaaacatctaaagctctgccacagcaggttcatcttcaattac
gtatatcatccaaaaggtgctaggatagatgtttcaatcaatgagtgttatgatggctcc
tatgcaggaaatcctcaggatatacatcgccaacctggatttgcttttagtcgaaatgga
ccggtaaagagaacacctatcacacatattcttgtttgcaggccaaaaagaacaaaagca
agcatgtcggagtttcttgaatctgaagatggagaagtggagcagcagagaacatacagc
agtggccacaatcgtctctatttccacagtgatacctgcttacctcttcggccacaagaa
atggaagtagatagtgaagatgagaaagatccagaatggctgagagaaaaaaccattact
caaattgaagaattttctgatgtgaatgaaggagagaaagaagtgatgaagctgtggaac
ctccatgtcatgaagcatggatttattgctgacaatcaaatgaatcatgcctgtatgctg
tttgtagaaaattatggacagaaaataattaagaagaatttatgtcgaaacttcatgctt
catctagtcagcatgcatgactttaatcttattagcataatgtcaatagataaagctgtt
accaagctccgagaaatgcagcaaaaactagaaaaaggagaatctgcgaccccttcaaat
gaagaaatagctgaggaacaaaatggaacagcaaatggattcagtgaaactaactcaaaa
gagaaagctttggaaactgacggtgtctcaggggttccaaaacagagcaagaaacaaaaa
ctctga

DBGET integrated database retrieval system