KEGG   Mus musculus (mouse): 53376Help
Entry
53376             CDS       T01002                                 

Gene name
Usp2, B930035K21Rik, Ubp41
Definition
ubiquitin specific peptidase 2 (EC:3.4.19.12)
Orthology
K11833  
ubiquitin carboxyl-terminal hydrolase 2/21 [EC:3.1.2.15]
Organism
mmu  Mus musculus (mouse)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
MGI: 
Ensembl: 
Vega: 
UniProt: 
Position
9; 9 B
AA seq 619 aa AA seqDB search
MSQLSSTLKRYTESSRYTDAPYAKPGYGTYTPSSYGANLAASFLEKEKLGFKPVSPTSFL
PRPRTYGPSSILDCDRGRPLLRSDIIGSSKRSESQTRGNERPSGSGLNGGSGFSYGVSSN
SLSYLPMNARDQGVTLSQKKSNSQSDLARDFSSLRTSDGYRTSDGYRTSEGFRIDPGNLG
RSPMLARTRKELCALQGLYQAASRSEYLTDYLENYGRKGSAPQVLTQAPPPSRVPEVLSP
TYRPSGRYTLWEKSKGQASGPSRSSSPGRDTMNSKSAQGLAGLRNLGNTCFMNSILQCLS
NTRELRDYCLQRLYMRDLGHTSSAHTALMEEFAKLIQTIWTSSPNDVVSPSEFKTQIQRY
APRFMGYNQQDAQEFLRFLLDGLHNEVNRVAARPKASPETLDHLPDEEKGRQMWRKYLER
EDSRIGDLFVGQLKSSLTCTDCGYCSTVFDPFWDLSLPIAKRGYPEVTLMDCMRLFTKED
ILDGDEKPTCCRCRARKRCIKKFSVQRFPKILVLHLKRFSESRIRTSKLTTFVNFPLRDL
DLREFASENTNHAVYNLYAVSNHSGTTMGGHYTAYCRSPVTGEWHTFNDSSVTPMSSSQV
RTSDAYLLFYELASPPSRM
NT seq 1860 nt NT seq  +upstreamnt  +downstreamnt
atgtcccagctctcctccaccctgaagcgctatacagaatcgtcccgctacacagatgcc
ccctatgccaaaccgggctatggcacctacaccccttcttcctatggggccaacctggcc
gcctccttcctggagaaggaaaaacttggtttcaagccggtctcccccaccagcttcctc
ccacggccccgcacctacggcccctcctccattctggactgtgacaggggccgccccctg
ctgagatctgacatcattgggagtagtaagcggtcagagagccagacccgtggcaatgaa
aggccctcgggcagtggactcaacggaggcagtggattttcttatggagtttccagcaac
tccctcagctacctgcccatgaatgccagagaccagggggtgaccctgagccagaagaaa
tcgaacagccaatcagacctggcccgggatttctccagcctccggacttcagatggctac
cggacttcagatggctaccggacctcagagggctttaggatagaccctggaaacctgggt
cgcagccccatgctggcccgcacgcgtaaggagctctgtgccctgcagggcctctaccaa
gcagccagccgttctgagtacctaacagactatctggagaactatggtcgaaagggcagt
gcaccacaggtgctcacgcaagcccctcctccctcccgagtccctgaagtcctcagtccc
acctaccgaccaagtggccgttacacactgtgggagaagagcaagggccaggcctctggg
cccagccgctccagttctccagggcgagacaccatgaattcaaagagtgcccagggtctg
gctggtcttcgaaaccttgggaacacgtgcttcatgaactcaattcttcagtgcctgagc
aacacccgagagctgagagattactgcctccagaggctgtacatgcgggacctcggccac
accagcagcgctcacacggccctcatggaagagtttgcaaaactaatccagaccatatgg
acgtcgtcccccaatgatgtggtgagcccatctgagttcaagacccagatccagagatat
gcgccacgcttcatgggctataatcagcaggatgctcaggaattccttcgtttccttctg
gatggtctccacaatgaggtgaaccgggtggcagcaaggcctaaggccagccctgagacc
cttgatcatctccctgatgaagaaaaggggcgacagatgtggaggaagtatctggaaagg
gaagacagtcggattggggatctcttcgttgggcagctgaagagctccctcacatgcacc
gattgtggctactgctctacagtcttcgatcccttctgggatctctcgttgcccatcgca
aagagaggttaccctgaggtgacgttaatggattgtatgaggctcttcaccaaagaggac
atattggatggtgatgagaagccaacttgctgccgctgccgagccagaaaacgatgcata
aaaaagttctctgtccagaggttcccaaagatcttggtgctccacctgaagcgattctca
gaatccaggatacgaaccagcaagctcacaacatttgtgaatttcccactaagagacctg
gacttgagagaatttgcttcagaaaacaccaaccatgctgtttacaacctgtatgctgtg
tccaatcactccggaaccaccatgggaggccactatacagcctactgccgaagtccggtt
acaggcgaatggcacactttcaatgattccagtgtcacacccatgtcctccagccaagtg
cgcaccagcgacgcctatttgctcttctatgaactggccagtccaccctcccgtatgtag

DBGET integrated database retrieval system