KEGG   Mus musculus (mouse): 53416Help
Entry
53416             CDS       T01002                                 

Gene name
Stk39, AW227544, AW556857, DCHT, RF005, Rnl5, SPAK
Definition
(RefSeq) serine/threonine kinase 39
  KO
K08835  serine/threonine-protein kinase OSR1/STK39 [EC:2.7.11.1]
Organism
mmu  Mus musculus (mouse)
Brite
Enzymes [BR:mmu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     53416 (Stk39)
Protein kinases [BR:mmu01001]
 Serine/threonine kinases: STE group
  STE20 family
   53416 (Stk39)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr OSR1_C Kinase-like APH Kdo Haspin_kinase
Motif
Other DBs
NCBI-GeneID: 53416
NCBI-ProteinID: NP_058562
MGI: 1858416
Ensembl: ENSMUSG00000027030
Vega: OTTMUSG00000012975
UniProt: Q9Z1W9 A2AQL0
Structure
PDB: 

Jmol
Position
2; 2 C1.3
AA seq 556 aa AA seqDB search
MAEPSGSPVHVQLSQQAAPVTAAAATAPAAATSAPAPAPAPAPAASAAPAPAPAAAPAPA
PAAQAVGWPICRDAYELQEVIGSGATAVVQAALCKPRQERVAIKRINLEKCQTSMDELLK
EIQAMSQCSHPNVVTYYTSFVVKDELWLVMKLLSGGSMLDIIKYIVNRGEHKNGVLEEAI
IATILKEVLEGLDYLHRNGQIHRDLKAGNILLGEDGSVQIADFGVSAFLATGGDVTRNKV
RKTFVGTPCWMAPEVMEQVRGYDFKADMWSFGITAIELATGAAPYHKYPPMKVLMLTLQN
DPPTLETGVEDKEMMKKYGKSFRKLLSLCLQKDPSKRPTAAELLKCKFFQKAKNREYLIE
KLLTRTPDIAQRAKKVRRVPGSSGHLHKTEDGDWEWSDDEMDEKSEEGKAAASQEKSRRV
KEENSEISVNAGGIPEQIQSLSVHDSQAQPNANEDYREGPCAVNLVLRLRNSRKELNDIR
FEFTPGRDTADGVSQELFSAGLVDGHDVVIVAANLQKIVDDPKALKTLTFKLASGCDGSE
IPDEVKLIGFAQLSVS
NT seq 1671 nt NT seq  +upstreamnt  +downstreamnt
atggcggagccgagcggctcgcctgtgcacgtccagctttcccagcaggcggccccggtg
acagcggcggcggcgacggccccggcggccgcgacatcagcaccagccccggccccggcc
ccggctccggcggcgtccgcagccccggccccggctccagctgctgctccagccccggcc
ccggcagctcaggcggtcggctggcccatctgcagggacgcgtacgagctccaggaggtt
atcggcagcggagcaactgcggtggttcaggcagccctatgcaaacccaggcaagaacgc
gtagccataaagcggatcaacttggaaaaatgccagacgagtatggatgaactcctgaaa
gaaattcaagccatgagccaatgcagccatcccaacgtagtgacttattacacctccttt
gtggtcaaagatgagctgtggctggtcatgaaattactaagtggaggttccatgttggat
atcatcaaatacatcgttaatcgaggagaacataaaaatggtgtcctagaagaggcgata
attgcaacaattcttaaggaggttttggaaggtttagactatctgcacagaaacggtcag
atccatagggatttgaaagctggaaatattcttctgggtgaggatggctcagtacaaata
gcagattttggagtaagcgcattcttagccacagggggtgatgttacacggaataaagtc
agaaaaacatttgttggtaccccatgttggatggcccctgaagtcatggaacaggtgaga
ggctatgacttcaaggctgatatgtggagttttggaataactgccattgaattagcaacc
ggagcagcgccttaccacaaataccctccaatgaaagtgctaatgctgactttgcaaaat
gacccgcccactttagaaactggtgtagaggataaagaaatgatgaaaaaatacggcaag
tccttcagaaagttactgtcactgtgtcttcagaaagatccttccaaaaggcccacagca
gcagaacttttaaaatgcaagttcttccagaaagccaagaacagagagtacctgatcgag
aagctgctgacaagaaccccagacatagcccaaagagccaagaaggtaaggcgagttcct
gggtcgagcggtcaccttcataagactgaagacggcgactgggagtggagcgatgacgag
atggatgagaagagcgaggaggggaaggcagccgcctcccaagagaagtcacgaagagta
aaagaagagaactcagagatctcggtgaatgctggtggcatccctgagcaaatacagtct
ctctctgtgcacgactctcaggcccaaccaaacgctaatgaagactacagagaaggtcct
tgtgcagtcaaccttgttttaagattaagaaactccagaaaggaacttaatgacatacga
tttgagtttactccaggaagagatacagcagacggtgtgtctcaggagctcttctctgct
ggcttggttgacggccatgatgtagttatagtggctgctaatttacagaagattgtagat
gaccccaaagctttaaaaacgttgacatttaagttggcttctggctgcgatgggtcggag
attcctgatgaagtgaagctgatcgggttcgcccagttgagtgtgagctga

DBGET integrated database retrieval system