KEGG   Mus musculus (mouse): 53886Help
Entry
53886             CDS       T01002                                 

Gene name
Cdkl2, 5330436L21Rik, AI505225, KKIAMRE, Kkm
Definition
(RefSeq) cyclin-dependent kinase-like 2 (CDC2-related kinase)
  KO
K08824  
cyclin-dependent kinase-like [EC:2.7.11.22]
Organism
mmu  Mus musculus (mouse)
Brite
Enzymes [BR:mmu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.22  cyclin-dependent kinase
     53886 (Cdkl2)
Protein kinases [BR:mmu01001]
 Serine/threonine protein kinases: CMGC group
  CDKL family
   53886 (Cdkl2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
MGI: 
Ensembl: 
Vega: 
UniProt: 
Position
5; 5 E2
AA seq 568 aa AA seqDB search
MEKYENLGLVGEGSYGMVMKCRNKDSGRIVAIKKFLESDDDKMVKKIAMREIKLLKQLRH
ENLVNLLEVCKKKKRWYLVFEFVDHTILDDLKLFPNGLDYQVVQKYLFQIINGIGFCHSH
NIIHRDIKPENILVSQSGVVKLCDFGFARTLAAPGEVYTDYVATRWYRAPELLVGDVKYG
KAVDIWAIGCLVIEMLMGQPLFPGESDIDQLHHIMTCLGNLIPRHQELFYKNPVFAGVRL
PEVKDAEAEPLESRYPKLPEAVISLAKKCLHIDPDKRPFCADLLRHDFFQMDGFAERFSQ
ELQLKIEKDARNNSLPKKSQNRKKEKDDALGEERKTLVVQDTNADPKIKDSKVFKVKGSK
IDVEKMEKGSRASNANCLHDNGTNHKGLASTSLRDCSNVNIDHSRNPGTAIPPLTHNLSA
VAPGINAGMGTIPGVQNYRVDEKTKKYCNPFVKPNQPPPAGIYNMNVSTSVSGEKYLLQA
NKKRKEYPKADVRLPELNYNHLPELRALEGIARNSRLIKKENKCLSESRIPSLAAIDLHV
SSVASHQGAGSPLSDDSEADLPRMEHQH
NT seq 1707 nt NT seq  +upstreamnt  +downstreamnt
atggagaagtacgagaacctaggattggttggagaggggagttacggaatggtgatgaag
tgtaggaacaaagacagtggaagaattgtggccattaagaagttcctagaaagtgacgat
gataaaatggttaagaagatcgcaatgcgagagatcaagttactaaagcaactgcggcat
gaaaatttggtgaatctgttggaagtatgtaagaaaaaaaaacgttggtacctagtcttt
gaatttgttgaccacacgattcttgatgacttgaaactctttccaaatggactagactat
caagtagttcaaaaatatttgtttcagattattaatggaattggattttgccacagtcac
aatatcatacacagagatataaagcctgagaatatattagtctcccagtctggcgttgta
aaattatgtgactttggatttgcacggaccctggcggctccaggggaggtttacactgac
tatgtggccacccggtggtacagagctccagaactgctggtcggtgacgtcaagtatggc
aaggctgtggatatctgggccattggttgtctggtcattgaaatgcttatggggcagcca
ctgtttccaggagaatctgatattgatcagctacatcatattatgacatgtttaggtaat
ttaattccaagacaccaggagctattttataaaaatcctgtgtttgctggagtaaggttg
cctgaggtcaaagatgcagaagcagagcctcttgagagccgctatcctaagctccctgaa
gctgtgatcagtttagcaaagaaatgcttgcacattgacccagacaaaaggcccttctgt
gctgaccttctgcgccatgacttctttcaaatggatggatttgctgagaggttttctcaa
gaattgcagttaaaaatagagaaagatgccaggaataattctttacctaaaaagtctcaa
aacagaaagaaagaaaaagacgatgccttaggtgaagaaagaaaaacccttgtggtacag
gataccaatgctgaccccaaaattaaggattcaaaagtatttaaagtaaaggggtcaaaa
attgatgttgagaaaatggaaaaaggaagtagagcttcaaatgccaactgtctccatgac
aatgggacaaaccacaaaggcttggcttccaccagcctcagagattgcagcaatgtcaac
attgatcactcaaggaacccaggcacagcgattcctcccctcacacacaatctttctgca
gttgctcctggcattaatgctggaatggggactattcctggcgttcagaattacagagtg
gatgagaaaacaaagaaatactgtaatccatttgttaaaccaaatcagcctcctccagca
gggatttataatatgaatgtgagcacatccgtctcaggtgaaaagtacctccttcaggca
aacaagaaaaggaaggaatatcccaaagcagacgtgcggttgcctgaactaaactataac
catcttcctgaactgagagctttagaaggcatagctcgaaattctaggctaataaagaaa
gagaacaaatgcctttcagaatctcgaattccctctctggctgccattgatctgcacgtg
tccagtgttgcatcacaccagggagcaggatcacccctgtcagatgattctgaggctgat
ttgcctcggatggaacaccaacactga

DBGET integrated database retrieval system