KEGG   Mus musculus (mouse): 53892Help
Entry
53892             CDS       T01002                                 

Gene name
Ppm1d, AV338790, Wip1
Definition
(RefSeq) protein phosphatase 1D magnesium-dependent, delta isoform
  KO
K10147  
protein phosphatase 1D [EC:3.1.3.16]
Organism
mmu  Mus musculus (mouse)
Pathway
p53 signaling pathway
Brite
KEGG Orthology (KO) [BR:mmu00001]
 Cellular Processes
  Cell growth and death
   04115 p53 signaling pathway
    53892 (Ppm1d)
Enzymes [BR:mmu01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.16  protein-serine/threonine phosphatase
     53892 (Ppm1d)
Protein phosphatases and associated proteins [BR:mmu01009]
 Protein Ser/ Thr phosphatases
  Mg2+- or Mn2+- dependent protein phosphatases (PPMs)
   PPM1 phosphatases (PP2C)
    53892 (Ppm1d)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
MGI: 
Ensembl: 
Vega: 
UniProt: 
Position
11 C; 11 51.34 cM
AA seq 598 aa AA seqDB search
MAGLYSLGVSVFSDQGGRKYMEDVTQIVVEPEPAAEDKPAPVPRRALGLPATPTLAGVGP
SEKGPAAARDPAPDAAASLPAGRCCRRRSSVAFFAVCDGHGGREAAQFAREHLWGFIKKQ
KGFTSSEPAKVCAAIRKGFLACHLAMWKKLAEWPKTMTGLPSTSGTTASVVIIRGMKMYV
AHVGDSGVVLGIQDDPKDDFVRAVEVTQDHKPELPKERERIEGLGGSVMNKSGVNRVVWK
RPRLTHSGPVRRSTVIDQIPFLAVARALGDLWSYDFFSGKFVVSPEPDTSVHTLDPRKHK
YIILGSDGLWNMVPPQDAISMCQDQEEKKYLMGEQGQSCAKMLVNRALGRWRQRMLRADN
TSAIVICISPEVDNQGNFTNEDELFLNLTDSPTYNSQETCVMTSSPSSTPPIKSPEEDAW
PRLSSKDHIPALVRSNAFSEKFLEVPAEIARGNIQTVVMTSKDSETLEENCPKALTLRIH
DSLNNTLSVGLIPTNSTNTIMDQKNLKMSTPGQMKAQEVERTPPANFKRTLEESNSGPLM
KKHRRNGLSRSSGAQASSLPTASQRRHSVKLTLRRRLRGQRKMGNPLLHQHRKTVCVC
NT seq 1797 nt NT seq  +upstreamnt  +downstreamnt
atggcggggctgtactcgctgggagtgagcgtcttctcggaccagggcgggaggaagtac
atggaggacgtaactcagatcgtggtggagcccgagccggctgcggaggacaagccggcg
ccggtaccgcggcgggcgctcgggttgccggcgacccccactctcgccggcgtcgggcca
tcggaaaaaggcccggcggcggcccgcgaccctgccccggacgccgcggcctcgctaccc
gctggccgctgctgtcgccgccgctcttcggtggccttctttgcagtgtgcgacgggcac
ggcggtcgggaggcggcacagtttgcccgggagcacttgtggggtttcatcaagaagcag
aaaggcttcacctcgtccgagcccgccaaggtgtgcgctgccatccgcaaaggtttcctc
gcctgtcacctcgccatgtggaagaaactggcagaatggccaaagactatgacaggtctt
cccagcacgtccgggacaactgccagtgtggttataatacggggcatgaagatgtatgta
gcgcatgtaggtgactctggggtggtccttggaattcaggatgacccaaaggatgatttt
gtgagagctgtggaggtgacacaagatcacaagccagaacttcccaaggaaagagaaaga
atcgaaggacttggcggcagtgtgatgaacaagtctggagtgaaccgagtagtttggaaa
aggccccggctcactcacagtggacctgtcagaaggagcacagtcattgaccagattcct
tttctggctgtagcaagagcgcttggtgacttgtggagctatgatttcttcagtggtaag
tttgtggtgtcacctgaaccagacaccagtgtccacactcttgacccccggaagcacaag
tatattatcctgggaagtgatggactttggaatatggttccacctcaagatgccatctcc
atgtgccaagaccaagaggagaaaaaatacttgatgggtgagcaaggacagtcctgtgcc
aaaatgcttgtgaatcgagcacttggccgctggaggcagcgtatgcttcgggcagataac
acaagtgccatcgtaatctgcatctctccagaagtagacaaccaagggaacttcaccaat
gaagatgagctctttctgaacctgactgatagccctacttacaacagccaggagacctgt
gtgatgacttcttctccaagttctacaccaccaatcaagtcaccggaagaagatgcatgg
ccaaggctgagctctaaggaccatatacctgcccttgttcgcagtaatgccttctcagag
aagtttttagaggtcccagctgagatagctagagggaatatccagactgtagtgatgacc
tcaaaagactcagagacacttgaagaaaattgccccaaagccctgactttaaggattcat
gattctttgaataatactctgtcagttggcctcattccaaccaattcaacaaatactatc
atggaccaaaaaaacttaaagatgtcaactccaggtcaaatgaaagctcaagaagttgaa
agaacccctccagccaattttaaaaggacattagaagaatccaactctggcccccttatg
aagaagcaccgacgaaatggcttaagtcgaagtagcggggcccaggcttccagtctccct
acagcatcccagcgcaggcactctgtcaaactgaccctgaggcgcagactcaggggccag
aggaagatgggaaatcctcttctccaccagcaccggaaaacagtgtgtgtgtgctga

DBGET integrated database retrieval system