KEGG   Mus musculus (mouse): 53973Help
Entry
53973             CDS       T01002                                 

Gene name
Cyp3a41a, Cyp3a41
Definition
cytochrome P450, family 3, subfamily a, polypeptide 41A (EC:1.14.14.1)
Orthology
K07424  
cytochrome P450, family 3, subfamily A [EC:1.14.14.1]
Organism
mmu  Mus musculus (mouse)
Pathway
Steroid hormone biosynthesis
Linoleic acid metabolism
Retinol metabolism
Metabolic pathways
Chemical carcinogenesis
Brite
KEGG Orthology (KO) [BR:mmu00001]
 Metabolism
  Lipid metabolism
   00140 Steroid hormone biosynthesis
    53973 (Cyp3a41a)
   00591 Linoleic acid metabolism
    53973 (Cyp3a41a)
  Metabolism of cofactors and vitamins
   00830 Retinol metabolism
    53973 (Cyp3a41a)
 Human Diseases
  Cancers
   05204 Chemical carcinogenesis
    53973 (Cyp3a41a)
Enzymes [BR:mmu01000]
 1. Oxidoreductases
  1.14  Acting on paired donors with incorporation of molecular oxygen
   1.14.14  With reduced flavin or flavoprotein as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.14.1  unspecific monooxygenase
     53973 (Cyp3a41a)
Cytochrome P450 [BR:mmu00199]
 Cytochrome P450, animal type
  CYP3 family
   53973 (Cyp3a41a)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
MGI: 
Ensembl: 
UniProt: 
Position
5 G2; 5 85.17 cM
AA seq 504 aa AA seqDB search
MNLFSALSLDTWVLLAIILVLLYRYGTRTHGLFKKQGIPGPKPLPFLGTVLNYYKGLWKF
DMECYEKYGKTWGLFDGQMPLFVITDPEMIKNVLVKECFSVFTNRREFGPVGIMSKAISI
SKDEEWKRYRALLSPTFTSGKLKEMFPVIEQYGDILVKYLMQEAEKGKPVTMKDVLGAYS
IDVITSTSFGVNVDSLNNPEDPFVEKAKGILRVDFFDPLVFSVVLFPFLTPVYEMLNICM
FPKDSIEFFKKFVNRMKESRLDSKQKHRVDFLQLMMNAHNNSKDKDSHKALSDMEITAQS
IVFIFAGYETTSSTLSFTLYCLATHPDIQKKLQEEIDETLPNKAPPTYDTVMEMEYLDMV
LNETLRLYPIGNRLERFCKKDVELNGVYIPKGSTVMIPSYALHHDPQHWPEPEEFQPERF
SKENKGSIDPYLYMPFGIGPRNCIGMRFAFMTMKLALTKVMQNFSFQPCQETQIPLKLSR
QGLLQPEKPIVLKVVPRDVVITGA
NT seq 1515 nt NT seq  +upstreamnt  +downstreamnt
atgaacctattttcagctctctcactggatacatgggtcctcctggcaatcatcctggtg
ctcctctaccgatatgggacccgtacacatggactttttaagaaacaggggattcctggg
cccaaacctctgccatttttaggcactgtgctgaattattacaagggtttatggaaattt
gacatggagtgctatgaaaagtatggaaaaacatgggggttgtttgatggtcaaatgcct
ctctttgtcatcacggacccagagatgattaagaatgttctagtgaaggaatgtttttct
gtcttcacaaaccggcgggaatttggcccagtggggataatgagtaaagctatctcaata
tctaaggatgaggaatggaagagatatagagctttgctgtcccccacattcaccagtgga
aaactcaaggagatgtttcctgtcattgaacagtatggagacattttggtaaagtacttg
atgcaagaggcagagaaaggcaagcctgttactatgaaagatgtgttaggtgcttacagc
atagatgtgatcaccagcacatcatttggagtgaatgtggattccctcaacaacccagag
gatccctttgtggagaaagccaaagggattttaagagttgacttttttgatcctttggtc
ttctcagttgtactttttccattcctgacaccagtatatgaaatgttaaatatctgcatg
ttcccaaaggattcaatagaatttttcaaaaaatttgtgaacagaatgaaggaaagccgc
ctcgattctaagcagaagcaccgagttgattttcttcagctgatgatgaacgctcataat
aattccaaagacaaagactctcataaagccctttctgacatggagatcacagcccagtca
attgtctttatttttgctgggtatgaaaccaccagtagcacactttccttcaccctgtat
tgtttggccactcaccctgatatccagaagaaactgcaggaagagatcgatgagactctg
cccaataaggcacctcccacctatgatactgtgatggagatggaatacctggatatggtg
cttaatgaaaccctcagattatatcccattggtaatagacttgagagattctgtaagaaa
gatgttgaactcaatggtgtgtatatccccaaagggtcaacagtgatgattccatcttat
gctcttcaccatgacccacagcactggccagagcctgaagaattccaacctgaaaggttc
agcaaagagaacaagggcagcattgatccttatttatatatgccctttggaattggaccc
aggaactgcattggcatgaggtttgctttcatgactatgaaacttgctctcactaaagtt
atgcagaacttttccttccagccttgtcaggaaacacagatacctctgaaattaagcaga
caaggacttcttcaaccagaaaaacccattgttctaaaggttgtaccacgggatgtagtt
ataactggagcatga

DBGET integrated database retrieval system