KEGG   Mus musculus (mouse): 54128Help
Entry
54128             CDS       T01002                                 

Gene name
Pmm2, AI585868, C86848
Definition
(RefSeq) phosphomannomutase 2 (EC:5.4.2.8)
  KO
K17497  
phosphomannomutase [EC:5.4.2.8]
Organism
mmu  Mus musculus (mouse)
Pathway
Fructose and mannose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mmu00001]
 Metabolism
  Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    54128 (Pmm2)
   00520 Amino sugar and nucleotide sugar metabolism
    54128 (Pmm2)
Enzymes [BR:mmu01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.8  phosphomannomutase
     54128 (Pmm2)
Protein phosphatases and associated proteins [BR:mmu01009]
 HAD phosphatases
  Other HAD phosphatases
   54128 (Pmm2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
MGI: 
Ensembl: 
Vega: 
UniProt: 
Position
16; 16 A1
AA seq 242 aa AA seqDB search
MATLCLFDMDGTLTAPRQKITEEMDGFLQKLRQKTKIGVVGGSDFEKLQEQLGNDVVEKY
DYVFPENGLVAYKDGKLLCKQNIQGHLGEDVIQDLINYCLSYIANIKLPKKRGTFIEFRN
GMLNVSPIGRSCSQEERIEFYELDKKEHIRQKFVADLRKEFAGKGLTFSIGGQISIDVFP
EGWDKRYCLRHLEHAGYKTIYFFGDKTMPGGNDHEIFTDPRTVGYTVTAPEDTRRICEGL
FP
NT seq 729 nt NT seq  +upstreamnt  +downstreamnt
atggccactctctgtctcttcgacatggatgggaccctgactgccccgcggcagaaaatt
acagaagaaatggatggctttctacaaaaattgaggcagaagaccaaaattggagtggta
ggtgggtcagattttgagaaactgcaagagcaactgggaaatgatgtggttgagaaatac
gattatgtgtttccagagaatggcttggtagcgtacaaagatgggaagctattgtgtaag
cagaatattcaagggcatctgggggaggatgtgatccaagacctgatcaactactgtctg
agctacattgcaaacattaaactccctaagaaaaggggaactttcattgaattccgaaat
ggcatgttgaatgtgtccccaattggaagaagctgcagccaagaagaacgaattgaattc
tacgaactcgataaaaaagaacatatacgacaaaagttcgtagcagacctgcggaaggag
tttgcagggaaaggcctcacgttctccataggtggccaaatcagcattgacgtctttcct
gaaggatgggataagcggtattgcctgagacacctggaacatgctggctataagaccatt
tatttctttggagacaagactatgccgggtggcaatgaccatgagatcttcacagacccc
agaactgtgggctacacagtgacggcccccgaagacacacgcaggatctgtgaggggctc
ttcccttga

DBGET integrated database retrieval system