KEGG   Mus musculus (mouse): 54169Help
Entry
54169             CDS       T01002                                 

Gene name
Kat6b, AI507552, B130044K16Rik, MYST-4, Morf, Myst4, mKIAA0383, qkf, querkopf
Definition
K(lysine) acetyltransferase 6B (EC:2.3.1.48)
Orthology
K11306  
histone acetyltransferase MYST4 [EC:2.3.1.48]
Organism
mmu  Mus musculus (mouse)
Brite
Enzymes [BR:mmu01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     54169 (Kat6b)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
MGI: 
Ensembl: 
Vega: 
UniProt: 
Position
14 A3; 14
AA seq 1763 aa AA seqDB search
MVKLANPLYTEWILEAVQKIKKQKQRPSEERICHAVSTSHGLDKKTVSEQLELSVQDGSV
LKVTNKGLASYKDPDNPGRFSSVKPGTFPKPTKGSKGPPCNDLRNVDWNKLLKRAIEGLE
EPNGSSLKNIEKYLRSQSDLTGTTNHPAFQQRLRLGAKRAVNNGRLLKEGPQYRVNSGSS
DGKGAPQYPSAFPSSLPPVSLLPHEKDQPRADPIPICSFCLGTKESNREKKPEELLSCAD
CGSSGHPSCLKFCPELTANVKALRWQCIECKTCSACRVQGKNADNMLFCDSCDRGFHMEC
CDPPLSRMPKGMWICQVCRPKKKGRKLLHEKAAQIKRRYAKPIGRPKNKLKQRLLSVTSD
EGSMSAFTGRGSPDTDIKISIKQESADVSLVGNKELVTEEDLDVFKQAQELSWEKIECES
GVEDCGRYPSVIEFGKYEIQTWYSSPYPQEYARLPKLYLCEFCLKYMKSKNILLRHSKKC
GWFHPPANEIYRRKDLSVFEVDGNMSKIYCQNLCLLAKLFLDHKTLYYDVEPFLFYVLTK
NDEKGCHLVGYFSKEKLCQQKYNVSCIMIMPQHQRQGFGRFLIDFSYLLSRREGQAGSPE
KPLSDLGRLSYLAYWKSVILEYLYRHHERHISIKAISRATGMCPHDIATTLQHLHMIDRR
DGRFVIIRREKLILGHMEKLKNCSRPNELDPESLRWTPMLISNAVVSEEEREAEKEAERL
MEQASCWEKEEQEILSSRVSSRQSSAKVQSKNKYLHSPERRPVAGERGQLLELSKESSEE
EEEEEEEDDEEEEEEEEEESIQTSPPRLTKPQSVSIKRKRPFVVKKKRGRKRRRINSSVT
TETISETTEVLNEPFDNSDEERPMPQLEPTCEIPVEEGGRKPVLRKAFPHQPGKKRQTEE
EEGEDNHFFKTAALCRKDVDDDAEHLKEGSKDNPEPLKCRQVWPKGAKRGLSKWKQSKER
KTGFKLNLYTPPETPMEPEDQVTIEEQKELSEDKGSPVGMEREVTETVDALLPQEGSRRE
ETGIPVSPHKSPGGKVDEEDLIRGEEEGEEEGEEEGEREEQEEEEEVTTEKDLDGAKSKE
NPEPEISMEKEDPVHLGDHEEDEDEEEEPSHNEDHDADDEDDGHMEAANMERGDLPRETF
KDALEGQEAFLDLSIQPSHSNPEVLMNCGVDLTMSCNSEPKELAGDTGTAPESDAEPPEE
QTQKQDQKNSDGVDAELEEGGPAAVEIDSETAQAVQSLTQENREHDDTFPDCAETQEACR
SLQNYTHTDQSPQIATTLDECQQSDHSSPVSSVHSHPGQSVRSVNSPSVPALENSYAQIS
PDQTAITVPPLQNMETSPMMDVPSVSDHSQQVVDSGFSDLGSIESTTENYENPSSYDSTM
GGSICGNGSSQNSCSYSSLTSSNLTQNSCAVTQQMSNISGSCSMLQQTSISSPPTCSVKS
PQGCVVERPPSSSQQLAQCSMAANFTPPMQLADIPETSNANIGLYERMGQSDFGAGHYPQ
PSATFSLAKLQQLTNTLIDHSLPYSHSAAVTSYANSASLSTPLSNTGLVQLSQSPHSVPG
GPQAQATMTPPPNLTPPPMNLPPPLLQRNMAASNIGISHSQRLQTQIASKGHVSMRTKAA
SLSPAAATHQSQIYGRSQTVAMQGPARTLTMQRGMNMSVNLMPAPAYNVNSVNMNMNTLN
AMNGYSMSQPMMNSGYHSNHGYMNQTPQYPMQMQMGMMGSQPYAQQPMQTPPHANMMYTA
PGHHGYMNTGMSKQSLNGSYMRR
NT seq 5292 nt NT seq  +upstreamnt  +downstreamnt
atggtaaaacttgcaaacccactttacacagagtggattcttgaagcagtgcagaaaatc
aagaagcagaagcagcggccctcagaagagaggatctgccatgcggtcagcacgtcccat
gggttggacaagaaaacagtctcggaacagctggaacttagtgttcaggatggctccgtt
ctcaaagtcaccaacaaaggccttgcttcatataaggacccagacaatcctgggcgtttt
tcatcggttaaaccgggcactttccccaagccaaccaaggggtccaaaggaccgccgtgt
aatgatctacgcaatgtggattggaataaacttttaaagagagcaatcgaaggccttgag
gagccaaacggctcctccttgaagaacattgagaagtatctgagaagccagagtgatctt
acaggcaccaccaaccatccagcctttcagcagaggttgcggctaggggccaagcgtgct
gtgaacaatgggaggttactgaaggaaggaccacagtacagggtcaatagtgggagctca
gatggcaaaggggcgccccagtaccccagtgcttttccgtcctcactcccgcccgtcagc
cttctaccccatgagaaagaccagccccgtgccgatcccattccaatatgtagcttctgt
ttggggactaaagagtcaaatcgtgaaaagaaaccagaagaactcctgtcttgtgcagat
tgtggcagtagtggacacccatcctgtctgaagttttgtcctgagttaaccgcaaatgtg
aaggccttgaggtggcagtgcatcgagtgcaagacgtgcagcgcatgtcgagtccagggc
aaaaatgcagataacatgcttttttgtgattcctgtgatagaggattccatatggagtgc
tgtgacccaccactttccagaatgccaaaagggatgtggatttgccaagtctgcagacca
aagaaaaagggaagaaaactacttcatgagaaagctgcacaaataaaacggcgatatgca
aaacccattggacgaccgaaaaataaattaaagcaacgattgttgtctgtaaccagtgat
gaaggatccatgagtgcattcacaggaagggggtcacctgatactgatattaaaataagc
atcaaacaagaaagtgcagatgtgagtctggtgggaaacaaggagctcgtgactgaagag
gatctggacgtttttaagcaggcccaggaactgtcttgggagaaaatagagtgtgaaagt
ggagtggaagactgtggtcggtacccctcagtaatagagttcgggaaatacgagatccaa
acctggtactcctcgccttacccacaggaatatgcaagattaccaaagctttacctgtgt
gaattctgtcttaaatatatgaagagtaaaaatattttgctaagacactcaaagaagtgt
ggatggtttcatcctccggccaatgagatttaccgaaggaaagacctttcagtattcgag
gttgatgggaatatgagtaaaatttattgccaaaacctttgcttgttagccaagctcttc
ctggaccacaaaacattgtattatgatgttgagccattccttttttatgtccttacaaaa
aatgatgaaaaaggctgtcatctggttggatacttctccaaggaaaagctctgccagcag
aagtataatgtgtcctgcataatgatcatgccccagcaccaaaggcaaggatttggacgc
tttctcattgatttcagctatttgctttctcgaagagaaggccaagcagggtctcccgaa
aagccgctctctgacctgggccggctctcctacctggcctactggaaaagtgtcatcttg
gaatacctctaccgccaccacgagaggcacatcagcatcaaggccattagcagagccaca
ggcatgtgcccacatgacatcgccaccactctgcagcacctccacatgattgacaggagg
gatggcaggtttgtcatcattagaagggaaaagttgatattgggccacatggaaaagctg
aagaactgttcccgacccaatgaacttgatccggagagtctaagatggaccccaatgtta
atttctaatgctgtggtttctgaggaagagcgagaagctgagaaggaggctgaacgacta
atggaacaagccagctgctgggagaaggaggagcaagagatcctgtcgtccagagttagc
agtaggcaatcgtctgcaaaagtacaatcaaagaataagtacctgcactccccagagagg
cggccagtggccggggagcgaggacagttgttagagctgtccaaagagagcagtgaggaa
gaggaggaggaggaggaggaagatgatgaggaagaggaggaggaggaagaggaggagagc
attcagacatctccccctcggttgactaagccacagtcagtttccattaaaagaaagagg
ccttttgtagtaaagaagaaaaggggtcgtaaacgcaggaggatcaacagcagtgtcacc
accgagaccatttccgagacgacagaagtgctcaatgagcccttcgacaactcggatgag
gagaggccaatgccgcagctggagcctacctgtgagatcccagtggaggagggcggcagg
aagccagttctgaggaaagcattcccacatcagccagggaagaaaaggcagacagaggaa
gaggaaggggaagacaatcatttcttcaagaccgctgccctttgtagaaaagatgtagat
gatgatgcagaacacttgaaagaaggcagcaaagacaatcctgagcctctaaagtgcaga
caagtgtggccaaaaggagcgaagcgagggctctccaagtggaagcaaagcaaggagagg
aagacgggcttcaagctgaacctgtacaccccaccagagacacccatggagccagaggac
caggtgacgatcgaagagcagaaggagctttcagaggacaagggcagccccgtggggatg
gaacgggaggtgacagagaccgtggatgccttgctgcctcaggaggggagcagaagggaa
gagacaggcatacccgtgagtccacataaatcaccaggtggaaaggtagatgaggaggac
ctcatcagaggtgaggaggagggagaggaagagggagaggaggagggagaacgagaagaa
caggaagaggaagaagaagtaactacagaaaaagacctagatggtgctaaaagtaaagag
aacccggagcctgagatctccatggaaaaggaagaccctgtgcatctgggtgaccatgaa
gaggacgaggatgaggaggaagagccatctcacaatgaggaccatgatgcagatgatgaa
gatgatggccacatggaggctgccaacatggagaggggagacctcccaagagaaaccttc
aaagacgcactagagggccaggaggcttttttagacctgagcattcagccgagtcactcg
aaccctgaagtcttgatgaactgcggtgttgatctcacaatgtcctgtaacagtgagcca
aaggagcttgctggggacactggaactgcacctgagtctgacgcggagcccccggaagaa
cagacacagaagcaggaccaaaagaacagcgatggtgtggatgctgagctcgaagaggga
ggcccagccgctgtggaaattgactccgagaccgcccaggctgttcagtctttgacccaa
gaaaacagggagcacgatgacacctttccagattgtgctgagactcaagaggcctgtaga
agcctgcagaactatacacacacagaccaaagtcctcaaattgccaccacgctggacgag
tgccaacagtcagaccacagtagcccagtttcatctgtccattcccatcctggccagtca
gttcgttctgtcaatagccccagtgtccctgccctagagaatagctatgcccaaatcagc
cccgatcagactgccatcacagtgccacctctgcagaacatggagaccagtccaatgatg
gacgtcccgtcagtgtcagatcactcacagcaggtcgttgacagcggattcagtgacctg
ggcagtattgagagcacaacagagaactatgagaacccaagcagctatgactcaaccatg
ggaggcagtatctgtggaaacggctcttcccagaacagctgctcctacagcagtctcacc
tctagcaatctgacacagaacagctgtgctgtcacccagcagatgtccaacatcagtggg
agctgcagcatgctgcagcagaccagcatcagctcccctccaacctgcagcgtcaagtct
ccccaaggctgtgtggtggagaggcctcccagtagcagccagcagctggctcagtgcagc
atggccgccaatttcaccccacccatgcagctggctgacatccccgagaccagcaatgcc
aacattggcttatatgagcgaatgggtcaaagtgattttggggctgggcactacccacag
ccatctgccaccttcagccttgccaaactgcagcagttaactaatacacttattgatcat
tcattgccttacagccattccgctgctgtgacctcctatgcaaacagtgcctctttgtcc
acaccattaagtaacacagggcttgttcagctttcgcagtctccacactctgtccctgga
gggccccaagcacaagctaccatgaccccaccccctaacctgactcctcctcccatgaat
ctgccaccacctctcctgcagcggaacatggctgcatcaaatattggcatctcccacagc
caaagactgcaaactcagattgccagcaagggccacgtctccatgagaaccaaggcggca
tctctgtcaccagctgccgccacccatcagtcacaaatctatgggcgttcccagactgta
gccatgcagggtcctgcacggactttaacgatgcaaagaggcatgaacatgagtgtgaac
ttgatgccagcgccagcctacaatgtcaactcggtgaacatgaacatgaacactctgaat
gccatgaatgggtatagcatgtcccagccgatgatgaacagtggttaccacagcaaccac
ggctatatgaatcaaaccccccagtaccctatgcagatgcagatgggcatgatgggaagc
cagccatacgcccagcagccaatgcagaccccaccccacgctaacatgatgtacacggcc
cccggacaccacggctacatgaacacaggcatgtccaaacagtctctcaatgggtcctac
atgagaaggtag

DBGET integrated database retrieval system