KEGG   Mus musculus (mouse): 54218Help
Entry
54218             CDS       T01002                                 

Gene name
B3galt4, Gal-T2, Galt2
Definition
UDP-Gal:betaGlcNAc beta 1,3-galactosyltransferase, polypeptide 4 (EC:2.4.1.62)
Orthology
K00715  
ganglioside galactosyltransferase [EC:2.4.1.62]
Organism
mmu  Mus musculus (mouse)
Pathway
Other types of O-glycan biosynthesis
Glycosphingolipid biosynthesis - ganglio series
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mmu00001]
 Metabolism
  Glycan biosynthesis and metabolism
   00514 Other types of O-glycan biosynthesis
    54218 (B3galt4)
   00604 Glycosphingolipid biosynthesis - ganglio series
    54218 (B3galt4)
Enzymes [BR:mmu01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.62  ganglioside galactosyltransferase
     54218 (B3galt4)
Glycosyltransferases [BR:mmu01003]
 Glycan extension
  Glycolipid
   54218 (B3galt4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
MGI: 
Ensembl: 
Vega: 
UniProt: 
Position
17 B1; 17
AA seq 371 aa AA seqDB search
MPLSLFRRVLLAVLLLVIIWTLFGPSGLGEELLSLSLASLLPAPASPGPPLALPRLLISN
SHACGGSGPPPFLLILVCTAPEHLNQRNAIRASWGAIREARGFRVQTLFLLGKPRRQQLA
DLSSESAAHRDILQASFQDSYRNLTLKTLSGLNWVNKYCPMARYILKTDDDVYVNVPELV
SELIQRGGPSEQWQKGKEAQEETTAIHEEHRGQAVPLLYLGRVHWRVRPTRTPESRHHVS
EELWPENWGPFPPYASGTGYVLSISAVQLILKVASRAPPLPLEDVFVGVSARRGGLAPTH
CVKLAGATHYPLDRCCYGKFLLTSHKVDPWQMQEAWKLVSGMNGERTAPFCSWLQGFLGT
LRCRFIAWFSS
NT seq 1116 nt NT seq  +upstreamnt  +downstreamnt
atgcccctcagcctcttccggcgcgtcctcctggcggtcctactactggtgatcatctgg
accctgtttggaccttcaggcttgggggaggagctgctgagcctgtccctggcatccctg
ctgccggccccagcctcgccaggaccgcccctcgccctgccccgcctcttgatttctaac
tctcatgcctgtggtggctccggaccccctcccttcctgctcatcctggtgtgtacggcc
ccggagcacctgaaccagagaaacgccattcgggcatcttggggtgccatccgcgaagcc
cggggtttcagagtgcagacgctcttcctcctgggaaaacctagaagacagcagcttgct
gacctgtcctcagagtcagcagcacacagggatatcttgcaggcctccttccaggattcc
taccgcaacctcaccctcaagaccctcagtggactgaactgggtgaacaaatactgtcct
atggcccgctacatcctcaagacggatgatgacgtgtatgtcaacgtcccagagctggtg
tcagagctgatacaaagaggggggccttcggagcaatggcagaagggcaaagaggcccag
gaagagacaacagctatccatgaagagcacagaggccaggcagtgccccttctgtattta
ggcagggtgcactggagggtgagacccactcggacaccagagtcccggcaccatgtgtca
gaagaactgtggccggaaaactggggtccttttccaccctatgcctcgggcacaggatat
gtactgtccatctctgctgtgcagctcatcctgaaggtggccagccgggccccacctcta
cctctagaggatgtctttgtgggagtaagtgcaaggcgagggggccttgcccccacacac
tgtgtcaaattggctggtgctacccactaccccttggatcggtgctgttacgggaagttc
ctgctgacatcccacaaggtggatccctggcaaatgcaggaagcttggaagctggtgagc
ggcatgaatggggagaggactgcacccttttgctcctggctccagggatttctgggtacc
ttgaggtgccggttcatagcctggttcagtagctga

DBGET integrated database retrieval system