KEGG   Mus musculus (mouse): 54401Help
Entry
54401             CDS       T01002                                 

Gene name
Ywhab, 1300003C17Rik
Definition
(RefSeq) tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, beta polypeptide
  KO
K16197  
14-3-3 protein beta/theta/zeta
Organism
mmu  Mus musculus (mouse)
Pathway
Cell cycle
Oocyte meiosis
PI3K-Akt signaling pathway
Hippo signaling pathway
Hepatitis B
Epstein-Barr virus infection
Viral carcinogenesis
Brite
KEGG Orthology (KO) [BR:mmu00001]
 Environmental Information Processing
  Signal transduction
   04390 Hippo signaling pathway
    54401 (Ywhab)
   04151 PI3K-Akt signaling pathway
    54401 (Ywhab)
 Cellular Processes
  Cell growth and death
   04110 Cell cycle
    54401 (Ywhab)
   04114 Oocyte meiosis
    54401 (Ywhab)
 Human Diseases
  Cancers
   05203 Viral carcinogenesis
    54401 (Ywhab)
  Infectious diseases
   05161 Hepatitis B
    54401 (Ywhab)
   05169 Epstein-Barr virus infection
    54401 (Ywhab)
DNA repair and recombination proteins [BR:mmu03400]
 Eukaryotic Type
  Check point factors
   Other check point factors
    54401 (Ywhab)
Exosome [BR:mmu04147]
 Exosomal proteins
  Proteins found in most exosomes
   54401 (Ywhab)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
MGI: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
2; 2 H3
AA seq 246 aa AA seqDB search
MTMDKSELVQKAKLAEQAERYDDMAAAMKAVTEQGHELSNEERNLLSVAYKNVVGARRSS
WRVISSIEQKTERNEKKQQMGKEYREKIEAELQDICNDVLELLDKYLILNATQAESKVFY
LKMKGDYFRYLSEVASGENKQTTVSNSQQAYQEAFEISKKEMQPTHPIRLGLALNFSVFY
YEILNSPEKACSLAKTAFDEAIAELDTLNEESYKDSTLIMQLLRDNLTLWTSENQGDEGD
AGEGEN
NT seq 741 nt NT seq  +upstreamnt  +downstreamnt
atgaccatggataagagtgagctggtacagaaagccaaactggctgagcaggctgagcgc
tatgatgacatggctgcagctatgaaggccgtaacagagcagggacacgaactctccaat
gaagagaggaatctactctctgttgcctacaagaacgtggtaggtgcccgccgctcttcc
tggcgtgtcatctccagcatcgaacagaaaaccgagaggaatgagaagaagcagcagatg
ggcaaagagtaccgtgagaagatcgaggcggagctgcaggacatctgcaacgatgtgctg
gagctgttggacaaatatctcattctcaatgccacccaggcagaaagcaaagtgttctac
ttaaaaatgaaaggagactactttaggtatctttctgaagttgcatccggagaaaataaa
caaaccacggtgtccaactcccagcaggcttaccaagaagcatttgaaatcagcaagaaa
gaaatgcagcctacacacccgattcgcctcggcctggcgctgaatttctcagtcttttac
tatgagattctaaactctcctgaaaaggcctgcagcctggccaaaacggcatttgatgag
gcgattgctgagttggacaccctgaatgaagagtcttacaaagacagcaccctgatcatg
cagctgctcagggacaatctcaccctgtggacgtcagaaaaccagggggatgaaggagat
gctggagagggagagaactaa

DBGET integrated database retrieval system