KEGG   Mus musculus (mouse): 545622Help
Entry
545622            CDS       T01002                                 

Gene name
Ptpn3, 9530011I20Rik, PTP-H1, PTPCL
Definition
(RefSeq) protein tyrosine phosphatase, non-receptor type 3
  KO
K18027  
tyrosine-protein phosphatase non-receptor type 3 [EC:3.1.3.48]
Organism
mmu  Mus musculus (mouse)
Brite
Enzymes [BR:mmu01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.48  protein-tyrosine-phosphatase
     545622 (Ptpn3)
Protein phosphatases and associated proteins [BR:mmu01009]
 Protein Tyrosine phosphatases (PTPs)
  Class I PTPs (Classical)
   Non-receptor PTPs
    545622 (Ptpn3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
MGI: 
Ensembl: 
Vega: 
UniProt: 
Position
4 B3; 4 31.66 cM
AA seq 913 aa AA seqDB search
MTSRLRALGGRINNTRTSELPKEKTRSEVICSIRFLDGLVQTFKVNKQDLGQSLLDMAYG
HLGVTEKEYFGLQHGDDPVDSPRWLEASKPLRKQLKGGFPCTLHFRVRYFIPDPNTLQQE
QTRHLYFLQLKMDVCEGRLTCPLNSAVVLASYAVQSHFGDFNSSIHHPGYLADSQFIPDQ
NDDFLSKVESLHEQHSGLKQSEAESCYINIARTLDFYGVELHGGRDLHNLDLMIGIASAG
IAVYRKYICTSFYPWVNILKISFKRKKFFIHQRQKQAESREHIVAFNMLNYRSCKNLWKS
CVEHHSFFQAKKLLPQEKNVLSQYWTLGSRNPKKSVNNQYCKKVIGGMVWNPVMRRSLSV
ERLETKSLPSRSPPITPNWRSPRLRHEIRKPRHSSADNLANEMTYITETEDVFYTYKGPL
SPKDSDSEVSQNHSPHRESLSENNPAQSCLTQKSSSSVSPSSNAPGSCSPDGVDQRFLED
YHKVTKGGFVEDASQYYCDKSDDGDGYLVLIRITPDEEGRFGFNLKGGVDQKMPLVVSRI
NPESPADTCMPKLNEGDQIVLINGRDISEHTHDQVVMFIKASRESHSRELALVIRRKAVR
SLAEIRSEDELSQLFPEAMFPACPEGGDSLEGSMELLKKGLESGTVLIQFEQLYRKKPGL
AVSFAKLPQNLDKNRYKDVLPYDTTRVLLQGNEDYINASYVNMEMPAANLVNKYIATQGP
LPNTCAQFWQVVWDQKLSLVVMLTTLTERGRTKCHQYWPDPPDIMDHGIFHIQCQTEDCT
IAYVSREMLVTNTETGEEHTVTHLQYVAWPDHGVPDDSSDFLEFVKYVRSLRVDGEPALV
HCSAGIGRTGVLVTMETAMCLIERNLPVYPLDIVRKMRDQRAMMVQTSSQYKFVCEAILR
VYEEGLVQRLDPS
NT seq 2742 nt NT seq  +upstreamnt  +downstreamnt
atgacctcccggttacgtgcgttgggtggaagaattaacaatacccgaacctctgaattg
cccaaagagaaaactcgatccgaggtcatctgcagcatacggtttttagatggcttggta
cagacctttaaagttaacaaacaagatttgggccagtcgcttctggatatggcctatggc
cacctgggtgtgacggagaaggaatacttcggcttgcaacatggcgacgacccagtggac
tctcctagatggcttgaggcaagcaaacccctcaggaagcagctgaaaggaggttttccc
tgtaccctgcattttcgagtaagatattttatacctgatcccaacacactgcagcaggag
caaaccaggcatctatatttcttacaactgaagatggatgtttgcgaaggaaggttaacc
tgccctctcaactcagcggtggttctagcctcgtacgcagtacaatctcattttggagac
tttaattcttcaatacatcatccaggctatcttgccgacagccagttcataccagatcaa
aatgatgactttttaagcaaggtggagtcactccatgaacagcacagtgggctaaagcag
tcggaagccgaatcttgctacatcaacatagctcgaacccttgacttctacggagtggag
cttcatggaggcagagatctgcacaacctagatctaatgatcgggattgcgtctgcaggc
attgcagtctaccgaaaatacatttgcacaagtttctacccttgggtgaacatactcaaa
atttctttcaaaaggaaaaagttcttcatacaccagcggcaaaaacaggctgaatccagg
gaacatatcgtggccttcaacatgctgaattaccgatcttgcaaaaacttgtggaaatcc
tgcgtcgaacaccattcgttctttcaggcaaaaaagttactacctcaggaaaagaatgtt
ctctctcagtactggactctaggctccaggaaccccaaaaagtctgtaaataaccaatat
tgcaaaaaggtgattggagggatggtgtggaacccagtcatgaggaggtccttatcagtg
gaacggctggaaaccaagagcctgccttcccggtcccctcccatcacccccaactggcga
agtcctcggctccggcatgaaatccgcaagccccgccattcctccgcggacaacctggcc
aatgagatgacctacatcacagaaaccgaggatgtgttctatacctacaagggacccctg
tcccccaaagacagcgactctgaagtctcccagaaccacagcccacaccgggagagtttg
tccgaaaacaacccagcccaaagctgcctgacccagaagtcatccagttctgtgtctcca
tcttcgaatgctccaggctcctgctctccagatggagttgaccagcggttcttagaagac
taccacaaggtgaccaaaggggggttcgtcgaggacgccagccagtactactgtgataag
agtgacgatggagatggctacctagtcctgatccggatcacaccagatgaagagggaaga
tttggctttaaccttaagggaggagtggatcaaaagatgccgctcgtggtctcgaggata
aacccagagtcacctgcagatacctgcatgcctaagctgaatgagggggatcagatcgtg
ttgatcaatggccgggacatctcagagcacactcatgaccaggtggtgatgttcatcaaa
gcaagccgggagtcccactcgagagaactggccctggtgatcaggagaaaagctgtgcgc
tcgctggcggagatcagatcagaagatgagctgagtcagcttttcccagaagccatgttt
cctgcatgtcctgagggtggggacagtctggagggatccatggagctgctgaagaaaggt
ctggaaagcggtacagtgttgatccagtttgagcaactctacagaaagaagcccggctta
gccgtctcatttgcaaagctgcctcagaatttggataaaaaccgatacaaagatgtgttg
ccttatgataccacgcgggtattattgcagggaaatgaagattacattaatgccagttat
gtgaacatggagatgcccgctgctaaccttgtgaacaagtacattgccactcagggaccg
ctgccaaacacctgtgcacagttttggcaagttgtctgggatcagaagttgtctcttgtt
gtcatgctgacgactctcaccgagcgagggcggaccaaatgtcaccagtactggccggat
ccccctgacatcatggaccatggcatctttcacatccagtgtcagacagaggactgtacc
attgcttacgtgtcccgagaaatgctagttacaaacacggagaccggggaagaacacaca
gtgacccatctccagtatgtggcgtggcctgaccacggcgtacctgatgactcatcagac
ttcctggagtttgtgaagtatgtgaggtccctgagggtcgacggtgagcctgccctcgtt
cactgcagtgctggaataggtcggacaggtgttttagtcactatggaaacagccatgtgc
ttaattgagaggaacctgcctgtttacccactggatattgtccggaaaatgagagaccag
cgcgcgatgatggtgcagacgtcaagccaatacaagtttgtgtgtgaagcgatccttcga
gtgtacgaagaaggcttagtccagaggctggatcccagttag

DBGET integrated database retrieval system