KEGG   Mus musculus (mouse): 54609Help
Entry
54609             CDS       T01002                                 

Gene name
Ubqln2, Chap1, Dsk2, HRIHFB2157, Plic-2, Plic2
Definition
(RefSeq) ubiquilin 2
  KO
K04523  
ubiquilin
Organism
mmu  Mus musculus (mouse)
Pathway
Protein processing in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:mmu00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    54609 (Ubqln2)
Proteasome [BR:mmu03051]
 Eukaryotic proteasome
  Proteasome interacting proteins (PIPs)
   UBL-UBA shuttle proteins
    54609 (Ubqln2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
MGI: 
Ensembl: 
Vega: 
UniProt: 
Position
X; X F3
AA seq 638 aa AA seqDB search
MAENGESSGPPRPSRGPAAAPGAASPPAEPKIIKVTVKTPKEKEEFAVPENSTVQQFKEA
ISKRFKSQTDQLVLIFAGKILKDQDTLMQHGIHDGLTVHLVIKSQNRPQGQATTQPSTTA
GTSTTTTTTTTAAAPAATTSSAPRSSSTPTTTNSSSFGLGSLSSLSNLGLNSPNFTELQN
QMQQQLLASPEMMIQIMENPFVQSMLSNPDLMRQLIMANPQMQQLIQRNPEISHLLNNPD
IMRQTLEIARNPAMMQEMMRNQDLALSNLESIPGGYNALRRMYTDIQEPMLNAAQEQFGG
NPFATVGSSSTSGEGTQPSRTENRDPLPNPWAPPPTTQTAATTTTTTTTSSGSGSGSSSS
STTAGNTMAAANYVASIFSTPGMQSLLQQITENPQLIQNMLSAPYMRSMMQSLSQNPDMA
AQMMLSSPLFTSNPQLQEQMRPQLPNFLQQMQNPETIAAMSNPRAMQALMQIQQGLQTLA
TEAPGLIPSFAPGVGMGVLGTAITPVGPVTPIGPIGPIVPFTPIGPIGPIGPTGPASSPG
STGTGIPPATTVSSSAPTETISPTSESGPNQQFIQQMVQALTGGSPPQPPNPEVRFQQQL
EQLNAMGFLNREANLQALIATGGDINAAIERLLGSQPS
NT seq 1917 nt NT seq  +upstreamnt  +downstreamnt
atggctgagaacggcgagagcagcggccccccgcgcccctcccgcggccctgcggcggcc
ccaggcgcggccagcccgccggccgagcccaaaatcatcaaagtcactgtgaagaccccc
aaagagaaggaggagttcgcggtgcccgagaacagcaccgtgcagcagttcaaggaagcg
atttccaaacgcttcaaatcgcagaccgatcagctcgtgctgattttcgccggaaagatc
ctgaaagatcaagataccttgatgcagcatggcatccatgatggactgactgttcacctg
gttatcaaaagccagaaccgtccgcagggccaggccaccacgcagcccagcacgactgcg
ggaacgagcacgacgaccacgaccaccaccacggcggcggcgccggcggcgacgacatca
tcggctcccaggagtagctccacacctaccaccacgaatagcagctcctttgggctggga
agcctttccagccttagtaacctgggcttgaactcgcccaacttcaccgagcttcagaac
cagatgcagcagcagctcctggccagccctgagatgatgatccagatcatggaaaatccc
tttgttcagagcatgctttcgaatcctgatctgatgaggcagctcatcatggccaatcca
cagatgcaacaattgatccagagaaacccagaaatcagccacctactgaacaacccagat
ataatgaggcagacgctggaaatcgccaggaatcctgccatgatgcaagagatgatgcga
aatcaagacctggctctcagtaatctcgaaagcatcccaggtggctacaatgctctgcgg
cgcatgtacactgacattcaagaacctatgctgaatgccgcacaggagcagtttgggggc
aacccgtttgccacggtggggagcagttccacctcaggggaaggtactcagccctcccgc
acggagaatcgtgatccgctgcccaatccttgggcaccaccgccaacaacccagacggct
gcgaccaccaccaccaccacgaccacaagcagtggcagtggctctggcagcagctccagc
agcaccaccgccgggaacaccatggctgcagctaattacgtggctagcatcttcagcacc
ccaggaatgcagagcctgctgcagcagataactgagaatccccagctgattcagaatatg
ctgtctgcgccctacatgcggagcatgatgcagtcgctgagccagaatccagatatggcg
gcccagatgatgctgagtagcccgctgttcacttcgaatcctcagctgcaggagcagatg
cgtccacagctcccgaatttcctgcagcagatgcagaatccagaaaccatcgcggccatg
tcaaacccgagagcgatgcaagcgctaatgcagatccagcaggggctacagactctagcc
actgaagcacctggcctcattcccagcttcgctccaggtgtggggatgggagtgctggga
accgccataacccctgtgggcccagtcactcccatagggcccatcggccctatagttcct
ttcacccccataggccccatcgggcctataggacccactggccctgcaagctcccccggc
tccaccggcactggcatcccgcctgcaaccactgtgtccagctctgcacctactgaaacc
ataagtccaacctcggaatctggacccaaccagcagttcattcaacaaatggtgcaggct
ctcactggaggaagccctccacagccgccgaatcctgaagtgagatttcagcagcaactg
gaacagctcaacgccatggggttcttaaaccgcgaagcaaacttgcaggccctaatagca
acaggaggcgacatcaacgcggccattgagaggctgctgggctctcagccatcctaa

DBGET integrated database retrieval system