KEGG   Mus musculus (mouse): 54611Help
Entry
54611             CDS       T01002                                 

Gene name
Pde3a, A930022O17Rik, C87899
Definition
(RefSeq) phosphodiesterase 3A, cGMP inhibited (EC:3.1.4.17)
  KO
K19021  
cGMP-inhibited 3',5'-cyclic phosphodiesterase A [EC:3.1.4.17]
Organism
mmu  Mus musculus (mouse)
Pathway
Purine metabolism
cGMP-PKG signaling pathway
cAMP signaling pathway
Renin secretion
Morphine addiction
Brite
KEGG Orthology (KO) [BR:mmu00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    54611 (Pde3a)
 Environmental Information Processing
  Signal transduction
   04024 cAMP signaling pathway
    54611 (Pde3a)
   04022 cGMP - PKG signaling pathway
    54611 (Pde3a)
 Organismal Systems
  Endocrine system
   04924 Renin secretion
    54611 (Pde3a)
 Human Diseases
  Substance dependence
   05032 Morphine addiction
    54611 (Pde3a)
Enzymes [BR:mmu01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.17  3',5'-cyclic-nucleotide phosphodiesterase
     54611 (Pde3a)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
MGI: 
Ensembl: 
UniProt: 
Position
6; 6 G1
AA seq 1141 aa AA seqDB search
MAVRGEAAQDLAKPGLGGASPARVARGNHRHRGESSPSPRGSGCCWRALALQPLRRSPQL
SSALCAGSLSVLLALLVRLVGGEVGGELEKSQEAAAEEEEEEGARGGVFPGPRGGAPGGG
AQLSPWLQPAALLFSLLCAFFWMGLCLLRAGVRLPLAVALLAACCAGEALVQLSLGVGDG
RLLSLPAAGVLLSCLGGATWLVLRLRLGVLMVAWTSVLRTVALVSLERFKVAWRPYLAYL
AAVLGLLLARYAEQILPQCSGPAPPRERFGSQLSARTKEEIPGWKRRRRSSSVVAGEMSG
CSGKSHRRTSLPCIPREQLMGHSEWDHKRGPRGSQSGTSITVDIAVMGEAHGLITDLLAD
PSLPPNVCTSLRAVSNLLSTQLTFQAIHKPRVNPTVTFSENYTCSDSEEGLEKDKQAISK
RLRRSLPPGLLRRVSSTWTTTTSATGLPTLEPAPVRRDRSASIKPHEAPSPSAVNPDSWN
APGLTTLTKSRSFTSSYAVSAANHVKAKKQNRPGGLAKISPVPSPSSSPPQGSPASSPVS
NSASQQFPESPEVTIKRGPGSHRALTYTQSAPDLSPQIPPPSVICSSCGRPYSQGNPADG
PSERSGPAMLKPNRTDDTSQVTSDYETNNNSDSSDILQNEEEAECQREPQRKASACGTYT
SQTMIFLDKPILAPEPLVMDNLDSIMDQLNTWNFPIFDLMENIGRKCGRILSQVSYRLFE
DMGLFEAFKIPVREFMNYFHALEIGYRDIPYHNRIHATDVLHAVWYLTTQPIPGLPSVIG
DHGSASDSDSDSGFTHGHMGYVFSKMYHVPDDKYGCLSGNIPALELMALYVAAAMHDYDH
PGRTNAFLVATSAPQAVLYNDRSVLENHHAAAAWNLFMSRPEYNFLVNLDHVEFKHFRFL
VIEAILATDLKKHFDFVAKFNAKVNDDVGIDWTNENDRLLVCQMCIKLADINGPAKCKEL
HLRWTEGIASEFYEQGDEEASLGLPISPFMDRSAPQLANLQESFISHIVGPLCHSYDSAG
LMPGKWVDDSDDSGDTDDPEEEEEEAETPHEDEACESSIAPRKKSFKRRRIYCQITQHLL
QNHMMWKKVIEEEQCLSGTENQSLDQVPLQHPSEQIQAIKEEEEEKGKPRAEETLAPQPD
L
NT seq 3426 nt NT seq  +upstreamnt  +downstreamnt
atggcagtgcggggcgaggccgcccaagacctagccaagccgggcctcggaggggcgagt
cccgcccgtgtggcaagagggaaccaccgccatcgtggcgagtcctctccatcccctcgg
ggctccggctgttgttggagagccctggcgctgcagccgctccggcgctcgcctcaactc
tcctcggcgctgtgcgcgggctccctgtccgtgctgctggcgctgctggtgaggctggtc
ggcggggaggtcggaggcgagctggagaagagtcaggaggcggcggccgaggaggaggag
gaggaaggagcccgagggggcgtcttcccgggccctcggggaggtgctcccgggggcggc
gcgcagctcagcccttggctgcagccggccgcgctgctcttcagtctcctgtgcgccttc
ttctggatgggcttgtgcctgctgcgcgccggggtgcgcctgcctctggccgtcgcgctg
ttggccgcctgctgcgccggggaagcgctggtgcagctctccttgggcgtgggggacggt
cgcctgctgtcgctgcccgccgcgggggtcctgctcagctgcctaggtggcgcgacatgg
ctggtgctgaggctgaggctgggcgtcctcatggtcgcctggactagcgtgcttaggacg
gtggccctggtttctctggagaggttcaaggtcgcctggagaccttacctggcatacttg
gcggccgtgcttgggctgctgctggccaggtacgccgagcagatcctgccgcagtgctcc
gggccggctccgcccagggagcggtttgggtcccagttgagcgcgaggaccaaggaagag
attccggggtggaagaggaggaggcggtccagctcggtggtggccggcgagatgtccggc
tgcagtggcaagtctcaccggaggacctccctgccctgcatacccagggagcagctcatg
ggccattcagaatgggaccacaagagagggccacgaggatcccagtcaggaaccagcatc
actgtggatattgctgtgatgggtgaggcccatggcctcattaccgacctcctggccgac
ccttctctgcccccgaatgtgtgtacatccttgagggccgtaagcaacttgctcagcacc
cagctcaccttccaggccatccacaagcccagagtgaaccccaccgtgaccttcagtgag
aactatacctgctcggactctgaggaaggcttggagaaagacaagcaggccatttccaag
cgcctgagaagaagtttgcctccaggcttactgagaagagtctcgtcaacttggacaact
accacctctgccacaggtctgcccaccttggagcctgcgccagtgcggagggaccgcagt
gccagcataaagccgcacgaagccccttcacccagtgctgtcaatcctgactcttggaat
gccccagggttgacgactctcaccaaaagcagatccttcacttcatcctatgctgtctct
gcagctaaccatgtaaaagctaaaaagcaaaacaggccaggtggccttgctaaaatttcc
cccgtcccctcaccctcctcctcgcctccccagggatcacctgccagcagtcctgtcagc
aacagtgcttcacaacagttcccagaatcccctgaagtaaccatcaagcgagggcctgga
tctcacagggccttaacttacacccaaagtgcccctgacctgtcccctcagatcccaccc
ccgtctgtcatatgtagcagctgtggcagaccttattcgcaagggaatcctgctgatgga
ccctcagagagaagtggcccagccatgctgaaaccaaacagaacagatgacacttctcaa
gttacctccgattatgagaccaacaacaacagtgacagcagtgacattctgcagaatgaa
gaggaagctgagtgccagagagaaccccagaggaaagcatcggcttgtggcacctatact
tcccagaccatgatcttcctggacaaaccaattcttgctccagaacccctggtcatggat
aacctggactcaattatggatcagttgaacacctggaattttccaatttttgatttaatg
gaaaatataggaagaaaatgtggccgtattctgagccaggtatcatacagactgtttgaa
gacatggggctctttgaagcctttaaaatcccggttagggagtttatgaattactttcat
gctttggagatcggatacagggacattccttatcataacagaatccatgccaccgatgtt
ctacacgctgtgtggtatctcacaacacagccgattcctggcctcccaagtgtgattggt
gatcacggctcagcaagcgactccgattctgacagtggatttacacacggacacatggga
tatgtgttttcaaaaatgtatcacgtgccagatgacaaatatggatgcctgtctgggaat
attccagccctagagttgatggctctgtacgttgctgcagccatgcatgactacgatcac
ccagggaggacaaatgccttcctggttgccactagtgcccctcaggcggtgctatacaac
gaccgttctgttctggagaaccatcacgccgctgcagcctggaatctcttcatgtcccgg
ccagagtataacttcttagttaacctggaccacgtggaattcaagcacttccgcttccta
gtcattgaagcgattttggctactgacctgaagaaacactttgactttgtagccaaattt
aacgccaaggtaaacgatgatgtcgggatagattggaccaatgaaaacgaccgtctcctg
gtgtgtcagatgtgtataaagctggctgacatcaacgggcctgctaaatgcaaagaactc
cacctgcggtggacagagggcatcgccagcgagttttatgagcagggcgatgaagaagcc
agcctcggcttgcccataagtccctttatggaccgctctgccccgcagctggccaatctt
caggaatcctttatctcacacatcgtgggtcctctctgccactcctatgactctgcggga
ctcatgccaggaaaatgggtagatgacagtgatgattccggagacaccgatgacccggaa
gaagaggaggaagaggctgaaacaccacacgaggacgaagcctgtgaaagcagtatagct
ccccgaaagaaaagtttcaaaagaaggagaatctactgccaaataactcagcaccttctg
cagaaccacatgatgtggaagaaagtgattgaagaggaacagtgtttatcaggcacagag
aaccagtccctggaccaggtccctctgcagcatccctcagagcagatccaggctatcaag
gaggaagaggaagagaaggggaagccaagagcagaggagaccctggctccacagccagac
ctgtga

DBGET integrated database retrieval system