KEGG   Mus musculus (mouse): 54644Help
Entry
54644             CDS       T01002                                 

Gene name
Otud5, AA407879, AI553596, BB114028, DUBA, DXImx46e, Sfc7
Definition
OTU domain containing 5 (EC:3.4.19.12)
Orthology
K12655  
OTU domain-containing protein 5 [EC:3.4.19.12]
Organism
mmu  Mus musculus (mouse)
Pathway
RIG-I-like receptor signaling pathway
Brite
KEGG Orthology (KO) [BR:mmu00001]
 Organismal Systems
  Immune system
   04622 RIG-I-like receptor signaling pathway
    54644 (Otud5)
Enzymes [BR:mmu01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     54644 (Otud5)
Peptidases [BR:mmu01002]
 Cysteine Peptidases
  Family C85: DUBA deubiquitinylating enzyme
   54644 (Otud5)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
MGI: 
Ensembl: 
Vega: 
UniProt: 
Position
X A1.1; X 3.54 cM
AA seq 567 aa AA seqDB search
MTILPKKKPPPPDADPANEPPPPGPLPPAPRRGAGVGVGGGGTGVGGGERDRDSGVVGAR
PRASPPPQGPLPGPPGALHRWALAVPPGAVAGPRPQQASPPPCGGPGGPGGGPGDALGAT
TAGVGAAGVVVGVGGTVGVGGCCSGPGHSKRRRQAPGVGAVGGASPEREEVGAGYNSEDE
YEAAAARIEAMDPATVEQQEHWFEKALRDKKGFIIKQMKEDGACLFRAVADQVYGDQDMH
EVVRKHCMDYLMKNADYFSNYVTEDFTTYINRKRKNNCHGNHIEMQAMAEMYNRPVEVYQ
YSTEPINTFHGIHQNEDEPIRVSYHRNIHYNSVVNPNKATIGVGLGLPSFKPGFAEQSLM
KNAIKTSEESWIEQQMLEDKKRATDWEATNEAIEEQVARESYLQWLRDQEKQARQVRGPS
QPRKASATCSSATAAASSGLEEWTSRSPRQRSSASSPEHPELHAELGIKPPSPGTVLALA
KPPSPCAPGTSSQFSAGGDRATSPLVSLYPALECRALIQQMSPSAFAGLNDWDDDEILAS
VLAVSQQEYLDSMKKNKVHREPPPDKS
NT seq 1704 nt NT seq  +upstreamnt  +downstreamnt
atgactattctccccaaaaagaagccgccacctcccgacgccgacccggccaacgaaccg
ccgccgcccgggccgctgcccccggcgcctcggcgcggtgcgggtgtaggcgtgggtggc
ggcggcacgggtgtgggcggaggagagcgcgaccgtgactccggcgtcgtgggggcccgt
ccccgggcttcgccgccacctcagggcccgctcccggggccgcctggtgctcttcatcgt
tgggcactggccgtgccgcctggcgcagtcgcgggccctcggccacagcaggcttctcca
cctccttgtgggggccccggtggccccggcggcggtcctggtgacgctcttggtgcgaca
actgcgggggtgggcgcggcaggggtggtggtgggcgtgggtggtaccgtgggcgtgggc
ggctgctgctcggggcccgggcacagcaagcggcggcgtcaagctcccggcgttggcgca
gttggcggggccagtccggaacgtgaagaggtcggagcgggctacaacagtgaagacgag
tatgaagctgccgcagcgcgaatcgaggccatggatcccgccactgtagaacagcaggaa
cactggtttgaaaaggccttgcgggacaagaaaggcttcatcatcaagcagatgaaggag
gacggtgcctgtctatttcgggctgtagctgaccaggtgtatggagaccaggacatgcat
gaggttgttcgaaagcattgcatggactatctgatgaagaacgctgattacttctccaac
tatgtcacagaagacttcaccacctatatcaaccggaagcggaaaaacaactgccatggc
aaccacattgaaatgcaggctatggcagagatgtacaaccgtcctgtggaggtgtatcaa
tatagcacagaacctatcaacacattccatgggatccatcaaaatgaagatgaacccatc
cgtgtcagctaccaccggaatatccactataattcagtggtgaatcctaacaaggccact
attggtgtggggctgggcctaccgtcatttaagccagggtttgcagagcagtccctgatg
aagaatgccataaagacatcagaagagtcatggattgaacagcaaatgctggaagacaag
aaacgagctacagactgggaggccacaaatgaggccatagaggagcaggtggctcgagaa
tcttaccttcagtggctgagggatcaagagaaacaggcccgccaggtccggggacccagc
cagccccggaaagccagtgccacatgcagttcagccacagcagcagcctccagtggcctg
gaggaatggactagtcggtccccacggcaacgaagttcagcctcgtcacctgagcaccct
gaactgcatgccgagctaggcattaagcccccttccccaggcactgtgttagctcttgcc
aaacctccttcaccctgtgcaccaggtacaagcagtcagttctcagcagggggtgatcgg
gccacctctcctcttgtgtccctctaccctgctctggagtgccgggccctcatccagcag
atgtccccctctgcctttgcaggtctgaatgattgggacgatgatgagatcctagcatcg
gtgctggcagtgtcccaacaggaatacctagacagtatgaagaaaaacaaagtgcacaga
gagccacccccagacaagagttga

DBGET integrated database retrieval system