KEGG   Mus musculus (mouse): 54651Help
Entry
54651             CDS       T01002                                 

Gene name
Usp27x, Sfc11, Usp27
Definition
ubiquitin specific peptidase 27, X chromosome (EC:3.4.19.12)
Orthology
K11366  
ubiquitin carboxyl-terminal hydrolase 22/27/51 [EC:3.4.19.12]
Organism
mmu  Mus musculus (mouse)
Brite
Enzymes [BR:mmu01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     54651 (Usp27x)
Peptidases [BR:mmu01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   54651 (Usp27x)
Transcription machinery [BR:mmu03021]
 Eukaryotic type
  RNA polymerase II system
   Coactivators
    SAGA/TFTC/STAGA complex
     54651 (Usp27x)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
MGI: 
Ensembl: 
Vega: 
UniProt: 
Position
X A1.1; X 3.31 cM
AA seq 438 aa AA seqDB search
MCKDYVYDIDIEQIAKEEQGEALKLQASTSTEVSQQQCSVPGLGEKYPTWETTKPELELL
GHNPRRRRIASSFTIGLRGLINLGNTCFMNCIVQALTHTPILRDFFLSDRHRCEMPSPEL
CLVCEMSSLFRELYSGNPSPHVPYKLLHLVWIHARHLAGYRQQDAHEFLIAALDVLHRHC
KGDDVGKVASNPNHCNCIIDQIFTGGLQSDVTCQACHGVSTTIDPCWDISLDLPGSCTSF
WPMSPGRESSLNGESHIPGITTLTDCLRRFTRPEHLGSSAKIKCGSCQSYQESTKQLTMK
KLPVVACFHFKRFEHSAKQRRKITTYISFPLELDMTPFMASSKETRVNGQLQLPTNSANN
ENKYSLFAVVNHQGTLESGHYTSFIRHHRDQWFKCDDAVITKASIKDVLDSEGYLLFYHK
QVLEPEPEKVKEMTPQAY
NT seq 1317 nt NT seq  +upstreamnt  +downstreamnt
atgtgtaaagactatgtgtatgacatagacattgagcaaattgccaaagaagagcaagga
gaagccttgaaattacaagcgtccacctcgacagaggtttctcagcaacagtgttcagtg
ccgggacttggggagaaatatcccacctgggaaacgaccaaacctgaactagaacttctg
gggcacaacccacggagaagaaggatcgcctccagctttaccatcggcttacgaggacta
attaatcttggcaacacgtgttttatgaactgcattgtccaggccttgacccacactcca
atactgagagatttctttctctctgacaggcaccggtgtgaaatgcccagccctgagttg
tgtctggtctgtgagatgtcgtcgctctttcgggagctgtattctggaaacccatctcct
catgtgccctataagttactgcacctggtgtggatacacgctcgtcatctagcagggtac
aggcagcaggatgcccacgagttcctcatcgctgcgctagatgtcctgcataggcactgc
aaaggtgacgatgttggcaaggtggccagcaaccccaaccactgtaactgcatcatagac
caaatcttcacaggtggcctgcagtccgatgtcacctgtcaagcctgccatggtgtctcc
accactatagacccatgctgggacattagtctggacttgcctggctcttgcacatccttc
tggcccatgagccctgggagggagagcagtttgaatggcgaaagccacatcccaggcatc
accactctcacggactgcttgcgaaggtttacaaggccagagcacttaggaagtagtgcc
aaaatcaagtgtggtagttgccaaagctaccaagaatctaccaaacagctcactatgaag
aagttaccagtagttgcctgctttcatttcaaacggtttgaacactcagcgaaacagagg
cgcaagatcactacgtacatttcctttcctctggagctggatatgacaccatttatggcg
tcaagtaaagagacccgggtgaatggacagttgcagctcccaaccaatagtgcgaacaac
gagaataagtattccttgtttgctgtggttaatcaccaaggaaccttggagagtggccac
tacaccagcttcattcggcaccacagggaccagtggttcaagtgtgatgatgccgtaatc
accaaggccagtattaaggatgtgctggacagtgaagggtatttactgttctatcacaaa
caggtcctggaacctgagccagaaaaggtgaaagaaatgactccacaagcctactga

DBGET integrated database retrieval system