KEGG   Mus musculus (mouse): 55994Help
Entry
55994             CDS       T01002                                 

Gene name
Smad9, MADH6, Madh8, Madh9, Smad8
Definition
(RefSeq) SMAD family member 9
  KO
K16791  
mothers against decapentaplegic homolog 9
Organism
mmu  Mus musculus (mouse)
Pathway
TGF-beta signaling pathway
Signaling pathways regulating pluripotency of stem cells
Module
BMP signaling
Brite
KEGG Orthology (KO) [BR:mmu00001]
 Environmental Information Processing
  Signal transduction
   04350 TGF-beta signaling pathway
    55994 (Smad9)
 Cellular Processes
  Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    55994 (Smad9)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
MGI: 
Ensembl: 
Vega: 
UniProt: 
Position
3; 3 C
AA seq 430 aa AA seqDB search
MHPSTPISSLFSFTSPAVKRLLGWKQGDEEEKWAEKAVDSLVKKLKKKKGAMDELERALS
CPGQPSKCVTIPRSLDGRLQVSHRKGLPHVIYCRVWRWPDLQSHHELKPLECCEFPFGSK
QKEVCINPYHYRRVETPVLPPVLVPRHSEYNPQLSLLAKFRSASLHSEPLMPHNATYPDS
FQQSLCPAPPSSPGHVFPQSPCPTSYPHSPGSPSESDSPYQHSDFRPVCYEEPQHWCSVA
YYELNNRVGETFQASSRSVLIDGFTDPSNNRNRFCLGLLSNVNRNSTIENTRRHIGKGVH
LYYVGGEVYAECVSDSSIFVQSRNCNYQHGFHPATVCKIPSGCSLKVFNNQLFAQLLAQS
VHHGFEVVYELTKMCTIRMSFVKGWGAEYHRQDVTSTPCWIEIHLHGPLQWLDKVLTQMG
SPHNPISSVS
NT seq 1293 nt NT seq  +upstreamnt  +downstreamnt
atgcaccccagcacccccatcagctccctcttctccttcaccagccccgcagtgaagcgg
ctgctgggctggaagcagggagatgaagaggagaagtgggcagagaaggcggtggactct
ttggtgaagaagttaaagaagaagaaaggcgccatggatgaactggagagggcgctgagc
tgcccgggtcagcctagcaagtgtgtcaccatcccacggtccctcgatggacgcctccag
gtgtcccaccgaaaggggctgccccacgtcatctactgccgcgtgtggcgctggccagac
ctgcagtcccatcatgagctgaagcccttggagtgctgtgagttcccgttcggctccaag
cagaaggaggtctgcatcaacccataccattaccgcagagtggagaccccagttctgcct
ccagtgctggtaccaagacacagcgagtacaaccctcagctcagcctcctggccaagttc
cgaagtgcctcgctgcacagcgaacccctcatgccgcacaacgccacctaccctgactct
ttccagcagtctctctgtccggcaccgccctcctcgccaggccatgtgtttccgcagtct
ccatgccccaccagctacccgcactcccccggaagtccttccgagtcagacagtccctat
caacactcagacttccggccagtttgctacgaggaaccccagcactggtgttctgttgcc
tactacgaactaaacaaccgggtcggagagactttccaggcgtcctcgcggagcgtgctc
atagacggcttcaccgacccttccaataacaggaataggttctgccttgggcttctctca
aatgtaaacagaaactcgaccatagaaaacaccaggaggcacattggaaagggtgtgcat
ttgtactacgttgggggcgaggtgtatgcggagtgcgtgagcgacagcagcatctttgtc
cagagccggaactgcaactaccagcacggcttccacccggccaccgtctgcaagatcccc
agcggctgcagcctcaaggtcttcaacaaccagctcttcgcccagctgctcgcccagtcc
gtgcaccacggctttgaagtggtgtatgagctgacgaagatgtgcacgattcggatgagc
tttgtgaagggctggggagcagagtatcatcgccaggatgtcacgagcaccccctgctgg
atcgagatccatcttcatggaccgctgcagtggttggataaggtgctcactcagatgggc
tccccacacaaccctatctcttcagtgtcttaa

DBGET integrated database retrieval system