KEGG   Mus musculus (mouse): 56012Help
Entry
56012             CDS       T01002                                 

Gene name
Pgam2
Definition
phosphoglycerate mutase 2 (EC:3.1.3.13 5.4.2.4 5.4.2.11)
Orthology
K01834  
2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
mmu  Mus musculus (mouse)
Pathway
Glycolysis / Gluconeogenesis
Glycine, serine and threonine metabolism
Metabolic pathways
Carbon metabolism
Biosynthesis of amino acids
Central carbon metabolism in cancer
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:mmu00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    56012 (Pgam2)
   01230 Biosynthesis of amino acids
    56012 (Pgam2)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    56012 (Pgam2)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    56012 (Pgam2)
 Human Diseases
  Cancers
   05230 Central carbon metabolism in cancer
    56012 (Pgam2)
Enzymes [BR:mmu01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     56012 (Pgam2)
Exosome [BR:mmu04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   56012 (Pgam2)
  Exosomal proteins of melanoma cells
   56012 (Pgam2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
MGI: 
Ensembl: 
Vega: 
UniProt: 
Position
11 A1; 11
AA seq 253 aa AA seqDB search
MTTHRLVMVRHGESLWNQENRFCGWFDAELSEKGAEEAKRGATAIKDAKIEFDICYTSVL
KRAIRTLWTILDVTDQMWVPVVRTWRLNERHYGGLTGLNKAETAAKHGEEQVKIWRRSFD
TPPPPMDEKHNYYTSISKDRRYAGLKPEELPTCESLKDTIARALPFWNEEIAPKIKAGQR
VLIAAHGNSLRGIVKHLEGMSDQAIMELNLPTGIPIVYELDQNLKPTKPMRFLGDEETVR
KAMEAVAAQGKAK
NT seq 762 nt NT seq  +upstreamnt  +downstreamnt
atgaccacccaccgcctagtaatggttcgccacggtgagagcttatggaaccaagagaac
cgtttctgtggctggtttgatgcagagctgagtgagaagggagcagaggaggccaagcgg
ggggccaccgctatcaaagatgccaagatagagtttgacatctgctacacgtcggtgctg
aagcgggcaatccgcaccctttggaccatcctggatgttacggaccaaatgtgggtgccc
gtggtgcgtacctggcgcctcaatgagcggcactatggtggcctcacaggcctcaataag
gctgagacggctgcaaagcacggggaggagcaggtgaagatctggaggcgttcctttgac
accccaccaccacccatggatgagaaacacaactactacacctccatcagcaaggaccgc
cgctatgcaggcttgaagcctgaggagctgcctacctgtgaaagtctcaaggacaccatt
gcccgggctttgcccttctggaatgaggagatcgcacctaagattaaggctggccagaga
gtgcttattgcagcccatgggaacagccttcggggcattgtgaaacatctggaagggatg
tccgaccaggccatcatggagctgaacctgcccactggaatccccattgtgtatgagctg
gaccagaacctgaagcccaccaagcccatgaggttcctgggagacgaagagacggttcgg
aaggccatggaagctgttgctgcccagggaaaggcgaagtga

DBGET integrated database retrieval system