KEGG   Mus musculus (mouse): 56012Help
Entry
56012             CDS       T01002                                 

Gene name
Pgam2
Definition
(RefSeq) phosphoglycerate mutase 2 (EC:3.1.3.13 5.4.2.4 5.4.2.11)
  KO
K01834  
2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
mmu  Mus musculus (mouse)
Pathway
Glycolysis / Gluconeogenesis
Glycine, serine and threonine metabolism
Metabolic pathways
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Glucagon signaling pathway
Central carbon metabolism in cancer
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:mmu00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    56012 (Pgam2)
   01230 Biosynthesis of amino acids
    56012 (Pgam2)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    56012 (Pgam2)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    56012 (Pgam2)
 Organismal Systems
  Endocrine system
   04922 Glucagon signaling pathway
    56012 (Pgam2)
 Human Diseases
  Cancers
   05230 Central carbon metabolism in cancer
    56012 (Pgam2)
Enzymes [BR:mmu01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     56012 (Pgam2)
Exosome [BR:mmu04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   56012 (Pgam2)
  Exosomal proteins of melanoma cells
   56012 (Pgam2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
MGI: 
Ensembl: 
Vega: 
UniProt: 
Position
11 A1; 11
AA seq 253 aa AA seqDB search
MTTHRLVMVRHGESLWNQENRFCGWFDAELSEKGAEEAKRGATAIKDAKIEFDICYTSVL
KRAIRTLWTILDVTDQMWVPVVRTWRLNERHYGGLTGLNKAETAAKHGEEQVKIWRRSFD
TPPPPMDEKHNYYTSISKDRRYAGLKPEELPTCESLKDTIARALPFWNEEIAPKIKAGQR
VLIAAHGNSLRGIVKHLEGMSDQAIMELNLPTGIPIVYELDQNLKPTKPMRFLGDEETVR
KAMEAVAAQGKAK
NT seq 762 nt NT seq  +upstreamnt  +downstreamnt
atgaccacccaccgcctagtaatggttcgccacggtgagagcttatggaaccaagagaac
cgtttctgtggctggtttgatgcagagctgagtgagaagggagcagaggaggccaagcgg
ggggccaccgctatcaaagatgccaagatagagtttgacatctgctacacgtcggtgctg
aagcgggcaatccgcaccctttggaccatcctggatgttacggaccaaatgtgggtgccc
gtggtgcgtacctggcgcctcaatgagcggcactatggtggcctcacaggcctcaataag
gctgagacggctgcaaagcacggggaggagcaggtgaagatctggaggcgttcctttgac
accccaccaccacccatggatgagaaacacaactactacacctccatcagcaaggaccgc
cgctatgcaggcttgaagcctgaggagctgcctacctgtgaaagtctcaaggacaccatt
gcccgggctttgcccttctggaatgaggagatcgcacctaagattaaggctggccagaga
gtgcttattgcagcccatgggaacagccttcggggcattgtgaaacatctggaagggatg
tccgaccaggccatcatggagctgaacctgcccactggaatccccattgtgtatgagctg
gaccagaacctgaagcccaccaagcccatgaggttcctgggagacgaagagacggttcgg
aaggccatggaagctgttgctgcccagggaaaggcgaagtga

DBGET integrated database retrieval system