KEGG   Mus musculus (mouse): 56207Help
Entry
56207             CDS       T01002                                 

Gene name
Uchl5, 5830413B11Rik, Uch37
Definition
ubiquitin carboxyl-terminal esterase L5 (EC:3.4.19.12)
Orthology
K05610  
ubiquitin carboxyl-terminal hydrolase L5 [EC:3.4.19.12]
Organism
mmu  Mus musculus (mouse)
Brite
Enzymes [BR:mmu01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     56207 (Uchl5)
Peptidases [BR:mmu01002]
 Cysteine Peptidases
  Family C12: ubiquitin C-terminal hydrolase family
   56207 (Uchl5)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
MGI: 
Ensembl: 
UniProt: 
Position
1 F; 1 62.54 cM
AA seq 328 aa AA seqDB search
MSSNAGEWCLMESDPGVFTELIKGFGCRGAQVEEIWSLEPESFEKLKPVHGLIFLFKWQP
GEEPAGSVVQDSRLETIFFAKQVINNACATQAIVSVLLNCTHQDVHLGETLSEFKEFSQS
FDAAMKGLALSNSDVIRQVHNSFARQQMFEFDTKTPAKEEDAFHFVSYVPVNGRLYELDG
LREGPIDLGACNQDDWITAVRPVIEKRIQKYSEGEIRFNLMAIVSDRKMIYEQKIAELQR
QLAEEPMDTDQGSTVLSAIQSEVARNQMLIEEEVQKLKRYKIENIRRKHNYLPFIMELLK
TLAEHQQLIPLVEKAKEKQNAKKAQETK
NT seq 987 nt NT seq  +upstreamnt  +downstreamnt
atgtcgagcaatgccggggagtggtgtctcatggaaagcgaccccggggtcttcaccgag
ctcattaaaggattcggttgccgaggggcccaagtagaagaaatatggagcttagaacct
gagagttttgaaaagctaaagccagttcatgggttaatttttcttttcaagtggcagcca
ggagaagaacctgctggctctgtggtccaggactccagacttgaaacaatattttttgcc
aagcaggtaattaataatgcttgtgccactcaggctatcgtaagtgtactactgaactgt
acgcatcaagatgtgcatttaggagagacattatcagaatttaaagaattttctcaaagt
tttgatgcagctatgaaggggctggcattgagtaactcagatgtgattcgacaagtgcac
aacagttttgccaggcagcagatgtttgaatttgatacaaagacaccagccaaagaggag
gatgcttttcactttgtcagttacgttccagtcaatgggaggctgtatgaactagacggg
ttaagagagggcccaattgatttaggtgcatgcaatcaagatgactggattactgcagtg
aggccagtaatagagaaaaggattcaaaagtatagtgaaggagaaattcgatttaattta
atggccattgtatctgacagaaaaatgatatatgaacagaagatagcagagttacaaaga
caacttgcagaggaacccatggatacagatcaaggtagtaccgtgttaagtgctattcag
tcagaagttgccagaaaccagatgcttattgaagaagaggtacaaaagttaaagagatat
aagattgaaaatatcagaaggaagcataattacttgcctttcattatggaattgttaaag
accttagctgagcaccagcagttaattccacttgtggaaaaggcaaaagaaaaacagaat
gcaaagaaagctcaggaaactaagtga

DBGET integrated database retrieval system