KEGG   Mus musculus (mouse): 56215Help
Entry
56215             CDS       T01002                                 

Gene name
Acin1, 2610036I19Rik, 2610510L13Rik, Acinus, Acn, C79325, acinusL, acinusS, mKIAA0670
Definition
(RefSeq) apoptotic chromatin condensation inducer 1
  KO
K12875  
apoptotic chromatin condensation inducer in the nucleus
Organism
mmu  Mus musculus (mouse)
Pathway
RNA transport
mRNA surveillance pathway
Spliceosome
Module
Exon junction complex (EJC)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 Genetic Information Processing
  Transcription
   03040 Spliceosome
    56215 (Acin1)
  Translation
   03013 RNA transport
    56215 (Acin1)
   03015 mRNA surveillance pathway
    56215 (Acin1)
Messenger RNA biogenesis [BR:mmu03019]
 Eukaryotic Type
  mRNA surveillance and transport factors
   Transport factors
    EJC complex
     56215 (Acin1)
Spliceosome [BR:mmu03041]
 Complex C
  Other components
   EJC/TREX
    56215 (Acin1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
MGI: 
Ensembl: 
Vega: 
UniProt: 
Position
14; 14 C3
AA seq 1338 aa AA seqDB search
MWGRKRPNSSGETRGILSGNRGVDYGSGRGQSGPFEGRWRKLPKMPEAVGTDPSTSRKMA
ELEEVTLDGKPLQALRVTDLKAALEQRGLAKSGQKSALVKRLKGALMLENLQKHSTPHAA
FQPNSQIGEEMSQNSFIKQYLEKQQELLRQRLEREAREAAELEEASAESEDEMTHPEGVA
SLLPPDFQSSLNRPELELSTHSPRKSSSFSEEKGESDDEKPRKGERRSSRVRQAKSKLPE
YSQTAEEEEDQETPSRNLRVRADRNLKIEEEEEEEEEEEDDDDEEEEEVDEAQKSREAEA
PTLKQFEDEEGEERTRAKPEKVVDEKPLNIRSQEKGELEKGGRVTRSQEEARRSHLARQQ
QEKETQIVSLPQEENEVKSSQSLEEKSQSPSPPPLPEDLEKAPVVLQPEQIVSEEETPPP
LLTKEASSPPTHIQLQEEMEPVEGPAPPVLIQLSPPNTDAGAREPLASPHPAQLLRSLSP
LSGTTDTKAESPAGRVSDESVLPLAQKSSLPECSTQKGVESEREKSAPLPLTVEEFAPAK
GITEEPMKKQSLEQKEGRRASHALFPEHSGKQSADSSSSRSSSPSSSSSPSRSPSPDSVA
SRPQSSPGSKQRDGAQARVHANPHERPKMGSRSTSESRSRSRSRSRSASSSSRKSLSPGV
SRDSNTSYTETKDPSCGQEAAAPSGPQLQVLEPKEKAPTFSASVRGRHLSHPEPEQQHVI
QRLQPEQGSPKKCEAEEAEPPAATQPQTSETQISHLLESERTHHTVEEKEEVTMDTSENR
PENEVPEPPLPVADQVSNDERPEGGAEEEEKKESSMPKSFKRKISVVSATKGVQAGNSDT
EGGQPGRKRRWGASTAATQKKPSISITTESLKSLIPDIKPLAGQEAVVDLHADDSRISED
ETERNGDDGTHDKGLKICRTVTQVVPAEGQENGQREEEEEKEPEAELPAPPQVSVEVALP
PPVEHEVKKVTLGDTLTRRSISQQKSGVSITIDDPVRTAQVPSPPRGKISNIVHISNLVR
PFTLGQLKELLGRTGTLVEEAFWIDKIKSHCFVTYSTVEEAVATRTALHGVKWPQSNPKF
LCADYAEQDELDYHRGLLVDRPSETKAEEQGAPRPLHPPPPPPVQPPPHPRAEQREQERA
VREQWAEREREMERRERTRSEREWDRDKVREGPRSRSRSRDRRRKERAKSKEKKSEKKEK
AQEEPPAKLLDDLFRKTKAAPCIYWLPLTESQIVQKEAEQAERAKEREKRRKEREEEEQK
EREKEAERERNRQLEREKRREHSRERERDRERERDRGDRERERERDRDRGRERDRRDTKR
HSRSRSRSTPVRDRGGRR
NT seq 4017 nt NT seq  +upstreamnt  +downstreamnt
atgtggggacggaaacgaccgaacagctccggagaaacccggggaattctgagcggtaat
agaggggtagactatggcagtgggcggggccaatccggtccgttcgaagggcgttggcgg
aaattaccgaagatgcccgaagccgtcgggacggacccgagtacctcacgcaagatggcg
gagctggaggaggtgactctggacgggaagcctcttcaggctctgcgggtgaccgacctg
aaggccgcactggagcagcgaggcctagccaagagcgggcagaagagtgccctggtcaag
cggctcaaaggggctctaatgctagaaaatttacaaaaacactcaacaccccatgctgca
ttccagccaaattcacagatcggggaggaaatgagccagaacagcttcataaagcagtat
ctggaaaagcagcaggagctacttaggcagcgcctggaacgggaagctcgggaggctgcg
gaacttgaagaagcctcagctgagtcggaggacgagatgacccatcctgagggagtggct
tccctgctgcctcctgattttcagagcagcctgaacagaccagagctggagctcagcaca
cattcaccccgaaagagctcctctttttctgaagaaaaaggagaatctgatgatgagaag
ccgaggaaaggggaaagacgatcatccagagttagacaggcaaaatctaaactccctgag
tacagtcagactgctgaggaggaagaggatcaagagacaccatctagaaacctgagggtc
agagcagatcgaaatttaaaaatagaggaggaggaagaagaagaggaagaagaagaagat
gacgatgatgaagaggaagaggaggtagatgaggcacagaaatctagagaggctgaggca
ccaaccctgaagcagtttgaggatgaagaaggggaagagaggaccagagcaaaaccagaa
aaggtggtggatgagaaacccctaaacatcagatcccaggaaaagggtgagttagagaaa
ggagggcgagttactagatcccaagaagaagctagaagaagtcatctggccagacagcaa
caagagaaagagacacaaattgtttctctccctcaagaagaaaatgaggtaaagtcttca
caaagtttggaggaaaaatcccagtctccctccccacctccgcttcctgaagacctagag
aaggcccctgttgtgctgcagccagaacagatagtcagtgaagaggaaacacccccacct
ttacttaccaaggaagcgtcatctccaccaactcatatacaactccaggaagagatggag
ccagtggaaggcccagcaccccctgtcctcattcagttgtctcctcctaacacagatgct
ggagccagggagccactagcgtctcctcaccctgcgcagctgctaagaagcctgtctcct
ttgtcaggtactacagacaccaaagcagagtctccagcagggagagtgtcagatgagagt
gtcctgcctctggctcagaaaagctcactgcctgaatgctccacccagaagggtgttgaa
agtgagcgtgaaaagtctgctcccctccctctaacagtggaggagttcgcacctgccaaa
ggcatcactgaggaacctatgaagaaacagtctttggaacagaaggagggcagaagagcc
tcccatgctctcttcccagagcacagtgggaagcagtcagccgactcatcctctagcagg
tcctcctccccttcatcctccagctctccatccagatctccatctcctgacagtgtggct
tcccgcccacagtcgtctccaggatctaagcagagagatggagcccaagcacgagttcat
gccaaccctcacgagagacccaagatgggctccaggtcaacttcagagtccaggtcacgt
tcccgatctcgttcccgttccgcgtcaagcagcagcagaaaatctctgagccctggagtc
tccagagatagcaacaccagctacactgaaaccaaagatccctcttgtggtcaggaggct
gcagctccatctgggccacagctgcaggtccttgaaccaaaggagaaggctcccacgttc
tcagcatctgtccgggggaggcatctgagccatcctgagccagagcaacagcacgtgatc
cagaggttgcagccggagcaggggagcccaaagaagtgtgaagctgaagaggcagagcca
ccagctgccacacagcctcaaacctcagagactcagatctctcatctgctagaatcagaa
aggactcatcacactgttgaagagaaggaggaagtgaccatggacaccagtgaaaacaga
cctgaaaatgaggtgcctgagcctcctctgcctgttgcagaccaagtcagcaatgatgag
cgcccagagggtggtgctgaagaagaggaaaagaaagagagttcgatgcccaagtcattc
aagaggaaaatctccgttgtctcagctaccaagggggtgcaagctggaaacagtgacaca
gaggggggccagcctggccgaaaacgccgttggggagccagcactgccgcgacacagaag
aaaccgtccatcagtatcaccactgagtcactcaagagcctcatccccgacatcaaaccc
ctggcggggcaggaggctgttgtggatcttcatgccgatgactcccgaatctctgaggat
gagacagagcgtaatggcgacgatgggacccatgacaagggactgaagatatgccggaca
gtcactcaggtagtacccgcagagggccaggagaatgggcagagggaagaggaagaagag
aaagagcctgaagccgagctgccggcgccaccccaggtgtcagtggaggttgccttgccc
ccacctgtggagcacgaagtaaagaaagtaacattaggagataccttaacccggaggtcc
atcagccaacagaagtctggagtttccattacaattgatgacccagtccggaccgcccag
gtgccctccccacccaggggcaagatcagtaacattgtccacatctccaacctggttcgt
cccttcactttaggccagctgaaggaattattggggcgtacaggaactttggtggaagag
gccttctggatagacaagatcaaatctcattgctttgtgacgtactctacagtagaggaa
gccgttgccacccgcacagctctgcacggggtcaagtggccccagtccaaccccaaattc
ctttgtgctgactatgctgagcaagatgagctggactatcaccggggactcttggtagat
cggccatctgaaactaaggcagaggaacagggagcaccaaggcccctgcatcccccaccc
ccacccccagtccagccaccgccccacccccgggctgagcagcgggagcaggaaagggct
gttcgagagcaatgggcagaacgggaacgggaaatggagcgccgggagaggactcggtct
gagagagaatgggatcgggacaaagttcgagagggaccccgctcccgatcacggtcccgt
gaccgccgccggaaagagcgagcaaaatctaaagaaaagaagagtgaaaagaaagaaaaa
gcccaggaggagccacctgccaagctgctggatgacctcttccgtaagactaaggcagct
ccctgcatctattggctccctctgactgagagccaaattgttcagaaggaggcagagcaa
gctgaacgggccaaggagcgggagaagcggcgaaaagaacgagaagaagaagaacaaaag
gaacgggagaaggaagctgagcgggaacggaaccggcagctagaacgggagaagaggagg
gagcacagcagggagagagagagggacagggagagagagcgggacaggggtgaccgagag
cgggagagggagcgagaccgagaccgaggcagggagagggatcgcagagacaccaagcgc
cacagcagaagccggagtcgaagcacacctgtacgggaccggggtgggcgccgctag

DBGET integrated database retrieval system