KEGG   Mus musculus (mouse): 56229Help
Entry
56229             CDS       T01002                                 

Gene name
Thsd1, 4833423O18Rik, Tmtsp
Definition
(RefSeq) thrombospondin, type I, domain 1
Organism
mmu  Mus musculus (mouse)
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
MGI: 
Ensembl: 
Vega: 
UniProt: 
Position
8; 8 A2
AA seq 851 aa AA seqDB search
MKPMLKDFSNLLLVVLCDYVLGEAEYLLLQEPVHVALSDRTVSVGFHYLSDVNGTLRNVS
VMLWEANTNRTLTTKYLLTNQAQGTLQFECFYFKEAGDYWFVMIPEVTDNGTQVPLWEKS
AFLKVEWPVFHIDLNRTAKAAEGTFQVGVFTTQPLCLFPVDKPDMLVDVIFTDRLPEARA
SLGQPLEIRASKRTKLTQGQWVEFGCAPVGVEAYVTVMLRLLGQDSVIASTGPIDLAQKF
GYKLMMAPEVTCESVLEVMVLPPPCVFVQGVLAVYKEAPKRPEERTFQVAENRLPLGERR
TVFNCTLFDVGKNKYCFNFGIVKKGHFSAKECMLIQRNIETWGPWQPWSPCSTTCGDAVR
ERRRLCVTSFPSRPSCSGMSSETSPCSLEECAVFRPPGPSPVSPQDPVKSNNVVTVTGIS
LCLFIIFATVLITLWRRFGRAPKCSTPVRHNSIHSPGFRKNSDEENICELSEPRGSFSDA
GDGPRGSPGDTGIPLTYRCSASAPPEDEASGSESFQSNAQKIIPPLFSYRLAQQQLKEMK
KKGLTETTKVYHVSQSPLTDTVVDATASPPLDLECPEEAAASKFRIKSPFLDQPGAGTGE
RPPSRLDGIVPPPGCAVSPSQTLIRKSQIRSTGGRDGSSERCHSRSSLFRRTASFHETKQ
SRPFRERSLSALTPRQVPAYSSRMRTWDQMEDRCRPPSRSTHLLPERPEHFQGAGRTSSP
LGPLSKSYTVGHPRRKPDPGDRQAGLVAGAEKMEPHRAHRGPSPSHRSASRKQSSPIFLK
DSYQKVSQLSPSHFRKDKCQSFPIHPEFAFYDNTSFRLTEAEQRMLDLPGYFGSNEEDET
TSTLSVEKLVI
NT seq 2556 nt NT seq  +upstreamnt  +downstreamnt
atgaaacccatgttgaaagacttttcaaatctcttgctggtggtgctctgtgactatgtc
ctcggagaagccgaatacctcctcctccaagagccagtccatgtggcactgagcgacaga
acggtgtcagtgggtttccactacctcagtgacgtcaacgggacactgaggaatgtgtct
gtcatgctgtgggaggccaacaccaatcggactcttaccactaagtacctcctgaccaac
caggcccaaggaacactccagtttgaatgtttctacttcaaagaggctggtgactactgg
tttgtaatgatcccggaagtgacagacaatggcacgcaagttccactctgggagaaaagt
gcctttctgaaggtagaatggcctgtctttcacattgatttaaataggacagccaaggca
gcagaaggcacctttcaagtgggtgtttttaccacccaaccgctctgcctgtttcccgtg
gacaagccagacatgctggtggatgttattttcactgaccgtcttccggaggcaagagca
agtttgggacagccgctggagatcagagccagcaaaaggacaaaactcactcaaggtcag
tgggtcgagtttggctgtgcaccggtaggggtggaagcctacgttacagtcatgctgagg
ctgttgggtcaagactcagtcattgcttctacgggacctattgacctggctcaaaaattc
ggatacaaattgatgatggcaccggaagtcacgtgtgagtctgtgctggaggtgatggta
ctgccacctccttgtgtcttcgtccaaggagtcctggctgtttacaaagaagcccccaaa
cgcccggaggagaggactttccaggtggctgaaaacagactgcccctgggagagaggaga
acggtgttcaactgcactttatttgatgtagggaagaacaaatactgttttaactttgga
attgtgaagaaaggccatttttctgcaaaggaatgcatgctaattcagagaaatatagaa
acttggggaccatggcagccgtggagcccgtgtagcaccacgtgcggggatgctgtccga
gagcgtcgccgcctgtgtgtcacttctttcccctccagacccagctgctctggaatgtcc
tcagagacctctccatgctccctggaggagtgtgctgttttccggccaccaggcccatcg
cctgtttcaccccaggaccctgtgaagtccaacaacgtggtgaccgtcacagggatctcc
ctgtgcctgttcatcatctttgccacggtgctcatcactctctggaggaggtttggccga
gcccccaaatgcagcacgcccgttcgccacaactccatccattcccctggcttccggaag
aactccgatgaagagaacatctgcgagctgagtgagcctcgcggaagcttctcggatgcc
ggtgacggacctaggggaagcccaggggacacgggcatcccattgacttacaggtgcagt
gcatcagcgcctcctgaggatgaggcctcgggcagtgagagcttccagtccaacgctcag
aagatcatcccgcccttgtttagctaccgccttgcccagcagcagctgaaggagatgaag
aagaaagggctgaccgagaccaccaaagtgtaccacgtatctcaaagccccctgacagac
actgtagtggatgccacggccagccctcccttagacctggaatgccccgaagaggctgca
gcaagcaagttccgaatcaaatctccatttctggaccagcctggggcaggtaccggggaa
aggcctccctccaggctggatggcatcgtgcctcctcctggctgtgcggtcagtcccagc
cagaccctgatccgaaagtcacagataaggtcgaccggtggcagagatggctcatcggag
aggtgccactccagaagttccctcttcaggaggactgctagttttcatgaaaccaagcag
tctcgccctttccgggagaggagtttgtcagccctgactccccgccaggtccccgcctac
agttccaggatgcggacctgggaccagatggaggatagatgtcggcctcccagtcgaagt
acccacctgcttccagagagaccagagcacttccaaggggcaggtcggaccagcagtcct
ttgggtccactctccaaatcctacactgtggggcatcccaggaggaaaccggacccaggg
gatcgtcaggccggattggtggcaggagctgagaaaatggagcctcaccgagctcacagg
ggaccgtcccccagtcacaggagtgcctcaaggaagcagtcttcccccattttcctcaaa
gatagctaccagaaagtcagtcagcttagcccttctcacttcagaaaagataaatgccag
agcttccccatccaccccgagttcgccttctatgacaatacctctttccgcctcaccgag
gctgagcagagaatgctggacctcccaggatacttcggctccaacgaagaggacgaaacc
acaagtacactcagtgtggagaagttagtgatctag

DBGET integrated database retrieval system