KEGG   Mus musculus (mouse): 56233Help
Entry
56233             CDS       T01002                                 

Gene name
Hdac7, 5830434K02Rik, HD7, HD7a, Hdac7a, mFLJ00062
Definition
histone deacetylase 7 (EC:3.5.1.98)
Orthology
K11408  
histone deacetylase 7 [EC:3.5.1.98]
Organism
mmu  Mus musculus (mouse)
Pathway
Alcoholism
Viral carcinogenesis
Brite
KEGG Orthology (KO) [BR:mmu00001]
 Human Diseases
  Cancers
   05203 Viral carcinogenesis
    56233 (Hdac7)
  Substance dependence
   05034 Alcoholism
    56233 (Hdac7)
Enzymes [BR:mmu01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.98  histone deacetylase
     56233 (Hdac7)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
MGI: 
Ensembl: 
Vega: 
UniProt: 
Position
15; 15 F2
AA seq 953 aa AA seqDB search
MDLRVGQRPTVEPPPEPALLTLQHPQRLHRHLFLAGLHQQQRSAEPMRLSMDPPMPELQG
GQQEQELRQLLNKDKSKRSAVASSVVKQKLAEVILKKQQAALERTVHPSSPSIPYRTLEP
LDTEGAARSVLSSFLPPVPSLPTEPPEHFPLRKTVSEPNLKLRYKPKKSLERRKNPLLRK
ESAPPSLRRRPAETLGDSSPSSSSTPASGCSSPNDSEHGPNPALGSEALLGQRLRLQETS
LAPFALPTVSLLPAITLGLPAPARADGDRRTHSTLGPRGPVLGNPHAPLFLHHGLEPEAG
GTLPSRLQPILLLDPSVSHAPLWTVPGLGPLPFHFAQPLLTTERLSGSGLHRPLNRTRSE
PLPPSATASPLLAPLQPRQDRLKPHVQLIKPAISPPQRPAKPSEKPRLRQIPSAEDLETD
GGGVGPMANDGLEHRESGRGPPEGRGSISLQQHQQVPPWEQQHLAGRLSQGSPGDSVLIP
LAQVGHRPLSRTQSSPAAPVSLLSPEPTCQTQVLNSSETPATGLVYDSVMLKHQCSCGDN
SKHPEHAGRIQSIWSRLQERGLRSQCECLRGRKASLEELQSVHSERHVLLYGTNPLSRLK
LDNGKLTGLLAQRTFVMLPCGGVGVDTDTIWNELHSSNAARWAAGSVTDLAFKVASRELK
NGFAVVRPPGHHADHSTAMGFCFFNSVAIACRQLQQHGKASKILIVDWDVHHGNGTQQTF
YQDPSVLYISLHRHDDGNFFPGSGAVDEVGTGSGEGFNVNVAWAGGLDPPMGDPEYLAAF
RIVVMPIAREFAPDLVLVSAGFDAAEGHPAPLGGYHVSAKCFGYMTQQLMNLAGGAVVLA
LEGGHDLTAICDASEACVAALLGNKVDPLSEESWKQKPNLSAIRSLEAVVRVHRKYWGCM
QRLASCPDSWLPRVPGADAEVEAVTALASLSVGILAEDRPSERLVEEEEPMNL
NT seq 2862 nt NT seq  +upstreamnt  +downstreamnt
atggacctgcgggtgggccagcggcccacggtggagcccccaccagagcctgcgctgctg
accctgcaacacccccaacgcctgcaccgccatctcttcctggcaggcttacaccagcaa
cagcgctcagccgagcccatgaggctctccatggacccaccaatgccggagctgcagggg
ggacagcaggagcaagaacttcggcaacttctcaataaagacaagagcaagcgaagtgcc
gtagccagcagtgtggtcaagcagaagctggctgaagtgatcctgaagaaacagcaggca
gcccttgagagaacagtccatcccagcagccccagtattccctacagaactcttgagccc
ttggacacagagggtgctgcccgctccgtgcttagcagcttcctgcctcctgttcccagc
ctgcccactgaacccccggaacactttcccttgcgtaaaacagtgtctgaacccaacctg
aagttgcgctacaaacccaagaaatccctggagagacgcaagaatcccctgctcaggaag
gagagtgccccgcccagccttcggaggaggcctgccgagacccttggagattcctccccc
agtagtagcagcacacccgcgtcagggtgcagctcccctaatgacagcgagcatggccct
aaccctgccctaggctcagaggcgctcttgggccagcggctgcggctgcaggagacttct
ctggccccgttcgctttgccgacagtgtccttgctgcccgcaatcacactggggctgcct
gcccctgccagggctgatggtgaccgcaggacccattcaactttaggccctcggggtcct
gtactggggaacccccatgctcccctcttcctgcaccacggtctggagccagaggctggg
ggcaccttaccctctcgcctgcaacccattctcctgctggacccctcagtctctcatgcc
ccactgtggactgtgcctggccttgggcccttgcccttccactttgcccagcccttactg
accaccgagcggctctctgggtcaggcctccatcgaccacttaaccggacccgctcagag
cccctgccccccagcgccacagcctcccctctgctggcccccctgcagccccgccaggat
cggctcaaacctcacgtccagctgatcaagccagccatctcccctccccagaggcctgcc
aagcccagtgagaagccccgactgcgacagataccctcggctgaggacctagagacagat
ggtgggggagtgggacctatggcgaatgatggcctggaacatagggagtcaggccgtggg
cctcctgagggcagaggctccatttctctgcagcagcatcaacaggtgccaccctgggag
cagcagcatctagccgggcggctctctcagggaagccccggggactccgtgctgatacct
ctggcccaggttggacaccggcccctgtccagaacccagtcttccccagcagcacctgtc
tccctgctgagcccagagcccacctgtcagacccaagtcctcaacagctcagagacacct
gctacagggctggtctatgactcggtgatgctgaaacaccaatgttcctgtggagacaac
agcaagcatcccgagcatgcaggccgcatccagagcatctggtcccggctgcaggaacgg
ggtctccgcagccagtgtgagtgtctccgaggccgaaaggcttccctagaggagctgcag
tcagtccactctgaacggcacgtgctcctctacggcacgaacccactcagccgcctcaaa
ctggataacgggaagcttacaggactcctggcacagcggacgtttgtgatgctaccctgt
ggcggggttggggtcgatactgacaccatctggaacgagctgcattcctccaatgcagcc
cgctgggctgcgggcagtgtcaccgaccttgccttcaaagtagcttcccgagagctgaag
aatggctttgctgtggtgcgacccccgggacaccatgcagatcattctacagccatgggc
ttctgcttcttcaactccgtggccatcgcctgccgacagctacagcaacacggcaaagcc
agcaagatcctcattgttgactgggatgttcaccatggcaacggcacacagcagactttc
taccaggaccccagtgtgctctacatttcccttcatcgccatgacgacggcaacttcttc
ccaggcagtggggccgtggatgaggtgggaactggcagtggcgagggcttcaatgtcaac
gtggcttgggctgggggcttggatccacccatgggggatcctgagtacctggctgctttc
aggatagtggtgatgcccattgcccgagagtttgctccagacctggtcctggtgtctgct
gggtttgatgctgcggagggtcacccagccccgctgggtggctaccatgtttctgccaaa
tgttttgggtacatgacgcagcagttgatgaacttggcaggaggcgccgtggtgttggcc
ttagagggtggacatgacctcacggccatctgtgatgcctcggaggcctgtgtagctgct
cttctgggcaacaaggtggaccccctttcagaagaaagctggaaacagaaacccaacctc
agtgccatccgctcgctggaagctgtggtcagggtgcacaggaaatactggggctgcatg
cagcgcttggcctcctgtccagactcctggctacccagagtgccgggagctgatgcagaa
gtggaagccgtgaccgcgctggcatccctttctgtgggcatcctggctgaagacaggccc
tcggagcggctggtggaagaggaagaacccatgaacctctag

DBGET integrated database retrieval system