KEGG   Mus musculus (mouse): 56248Help
Entry
56248             CDS       T01002                                 

Gene name
Ak3, AA407498, AI506714, AK-3, Ak3l, Ak3l1, Akl3l
Definition
(RefSeq) adenylate kinase 3 (EC:2.7.4.10)
  KO
K00944  
nucleoside-triphosphate--adenylate kinase [EC:2.7.4.10]
Organism
mmu  Mus musculus (mouse)
Pathway
Purine metabolism
Module
Adenine ribonucleotide biosynthesis, IMP => ADP,ATP
Brite
KEGG Orthology (KO) [BR:mmu00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    56248 (Ak3)
Enzymes [BR:mmu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.10  nucleoside-triphosphate---adenylate kinase
     56248 (Ak3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
MGI: 
Ensembl: 
Vega: 
UniProt: 
Position
19; 19 C1
AA seq 227 aa AA seqDB search
MGASGRLLRAVIMGAPGSGKGTVSSRITKHFELKHLSSGDLLRQNMLQGTEIGVLAKTFI
DQGKLIPDDVMTRLALHELKTLTQCSWLLDGFPRTLPQAEALDKVYQIDTVINLNVPFEV
IKQRLTARWIHPASGRVYNIEFNPPKTVGIDDLTGEPLIQREDDKPETVIKRLKAYEAQT
EPVLQYYQKKGVLETFSGTETNKIWPHVYSFLQTKVPETTQKASVTP
NT seq 684 nt NT seq  +upstreamnt  +downstreamnt
atgggggcgtcggggcggctgctgcgcgccgtgatcatgggggccccgggctccggcaag
ggcaccgtgtcgtcacgcatcaccaaacacttcgagctgaagcacctctccagcggggac
ctgctccgccagaacatgctgcagggcacagaaatcggtgtgttggccaagactttcatt
gaccaaggaaagctgatcccagatgacgtcatgactcggctggcccttcacgagctcaaa
acccttacccagtgtagctggctgttggatggatttccaaggacacttccacaggcagaa
gccctggataaagtttatcagatagacacagtgataaatctcaacgtgccctttgaggtc
attaaacagcgccttactgctcgctggatacatcctgccagtggtcgagtatacaacatt
gaattcaaccctcccaagactgtgggcattgatgacctgaccggagaacctctgattcag
cgcgaggatgacaaaccagagacagtgatcaagagactaaaggcctatgaagcccagaca
gagccggtcctgcagtattaccagaaaaaaggggtgttggaaacattctctggaacagaa
accaacaagatctggccccacgtatactccttcctacagacgaaagttccagaaactacc
caaaaggcctctgttactccctga

DBGET integrated database retrieval system