KEGG   Mus musculus (mouse): 56354Help
Entry
56354             CDS       T01002                                 

Gene name
Dnajc7, 2010003F24Rik, 2010004G07Rik, CCRP, Ttc2, mDj11, mTpr2
Definition
(RefSeq) DnaJ heat shock protein family (Hsp40) member C7
  KO
K09527  
DnaJ homolog subfamily C member 7
Organism
mmu  Mus musculus (mouse)
Brite
Chaperones and folding catalysts [BR:mmu03110]
 Heat shock proteins
  HSP40 / DNAJ
   56354 (Dnajc7)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
MGI: 
Ensembl: 
Vega: 
UniProt: 
Position
11 D; 11 63.47 cM
AA seq 494 aa AA seqDB search
MAATAECDVVMAATEPELLEDEDAKREAESFKEQGNAYYAKKDYNEAYNYYTKAIDMCPN
NASYYGNRAATLMMLGRFREALGDAQQSVRLDDSFVRGHLREGKCHLSLGNAMAACRSFQ
RALELDHKNAQAQQEFKNANAVMEYEKIAEVDFEKRDFRKVVFCMDRALEFAPACHRFKI
LKAECLAMLGRYPEAQFVASDILRMDSTNADALYVRGLCLYYEDCIEKAVQFFVQALRMA
PDHEKACVACRNAKALKAKKEDGNKAFKEGNYKLAYELYTEALGIDPNNIKTNAKLYCNR
GTVNSKLRQLEDAIEDCTNAVKLDDTYIKAYLRRAQCYMDTEQFEEAVRDYEKVYQTEKT
KEHKQLLKNAQLELKKSKRKDYYKILGVDKNASEDEIKKAYRKRALMHHPDRHSGASAEV
QKEEEKKFKEVGEAFTILSDPKKKTRYDSGQDLDEEGMNMGDFDANNIFKAFFGGPGGFS
FEASGPGNFYFQFG
NT seq 1485 nt NT seq  +upstreamnt  +downstreamnt
atggcggctaccgcggagtgcgatgtggtaatggcggcgaccgagcctgaactgctggag
gacgaagacgccaagagggaagcagaatccttcaaggaacaagggaatgcatattatgct
aagaaggactacaacgaagcttataactattacacaaaagccatagatatgtgtcctaac
aatgccagctattacggtaatcgagcggccacactgatgatgcttggacggttccgggaa
gctcttggagatgcgcagcagtctgtgaggttggatgacagttttgtccggggacacctc
cgagaaggcaagtgccacctctcacttgggaatgcaatggcggcatgtcgtagtttccaa
agagccctagaactggatcataaaaatgcccaggcacagcaggagttcaagaacgccaat
gccgtcatggagtatgagaaaatagcagaagtggattttgaaaagcgagatttccggaag
gttgttttctgcatggaccgtgccctagaatttgcccctgcctgccatcgattcaaaatt
ctcaaagcagaatgtttagcaatgcttggtcgatacccagaagcacagtttgtggccagt
gacattttacgaatggattccaccaatgctgatgctctgtatgtccggggtctttgcctt
tattacgaagattgtattgagaaggcagtgcagttttttgtacaggctctcaggatggct
cctgaccacgagaaggcttgtgtcgcttgtagaaatgccaaagcccttaaagccaagaag
gaagatgggaataaagcctttaaggaaggaaattacaagctagcatatgaactgtacaca
gaagccttggggatagatcccaacaacataaaaacaaatgctaaactctactgtaatcgg
ggtacggttaattccaagcttaggcaactggaagatgccatagaagactgtacaaatgcg
gtgaagctcgatgacacttacatcaaagcctacctgagaagagctcagtgttacatggac
acagagcagtttgaagaagccgtgcgggactatgaaaaagtgtatcagacggagaaaaca
aaagaacacaaacagctccttaagaatgcacagctggaactgaagaagagcaagaggaaa
gattactacaagatcctgggagtggacaagaatgcctctgaggacgagatcaagaaagct
taccggaaacgggccttgatgcaccatccagatcggcacagtggggccagtgccgaagtt
cagaaggaggaggagaagaagtttaaggaagtgggagaggcctttaccatcctctctgat
cccaagaaaaagactcgttatgacagtggacaggacttggatgaggagggcatgaatatg
ggcgattttgatgcaaacaacatcttcaaggcattcttcggtggtcctgggggcttcagc
tttgaagcatctggcccagggaatttctactttcagtttggctaa

DBGET integrated database retrieval system