KEGG   Mus musculus (mouse): 56354Help
Entry
56354             CDS       T01002                                 

Gene name
Dnajc7, 2010003F24Rik, 2010004G07Rik, CCRP, Ttc2, mDj11, mTpr2
Definition
(RefSeq) DnaJ heat shock protein family (Hsp40) member C7
  KO
K09527  DnaJ homolog subfamily C member 7
Organism
mmu  Mus musculus (mouse)
Brite
Chaperones and folding catalysts [BR:mmu03110]
 Heat shock proteins
  HSP40 / DNAJ
   56354 (Dnajc7)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: TPR_1 TPR_2 DnaJ TPR_8 TPR_11 TPR_17 TPR_19 TPR_16 TPR_12 TPR_14 TPR_9 TPR_7 ANAPC3 TPR_6 TPR_10 RPT MIT RPN7 TPR_3
Motif
Other DBs
NCBI-GeneID: 56354
NCBI-ProteinID: NP_062769
MGI: 1928373
Ensembl: ENSMUSG00000014195
Vega: OTTMUSG00000002027
UniProt: Q9QYI3
Position
11 D; 11 63.47 cM
AA seq 494 aa AA seqDB search
MAATAECDVVMAATEPELLEDEDAKREAESFKEQGNAYYAKKDYNEAYNYYTKAIDMCPN
NASYYGNRAATLMMLGRFREALGDAQQSVRLDDSFVRGHLREGKCHLSLGNAMAACRSFQ
RALELDHKNAQAQQEFKNANAVMEYEKIAEVDFEKRDFRKVVFCMDRALEFAPACHRFKI
LKAECLAMLGRYPEAQFVASDILRMDSTNADALYVRGLCLYYEDCIEKAVQFFVQALRMA
PDHEKACVACRNAKALKAKKEDGNKAFKEGNYKLAYELYTEALGIDPNNIKTNAKLYCNR
GTVNSKLRQLEDAIEDCTNAVKLDDTYIKAYLRRAQCYMDTEQFEEAVRDYEKVYQTEKT
KEHKQLLKNAQLELKKSKRKDYYKILGVDKNASEDEIKKAYRKRALMHHPDRHSGASAEV
QKEEEKKFKEVGEAFTILSDPKKKTRYDSGQDLDEEGMNMGDFDANNIFKAFFGGPGGFS
FEASGPGNFYFQFG
NT seq 1485 nt NT seq  +upstreamnt  +downstreamnt
atggcggctaccgcggagtgcgatgtggtaatggcggcgaccgagcctgaactgctggag
gacgaagacgccaagagggaagcagaatccttcaaggaacaagggaatgcatattatgct
aagaaggactacaacgaagcttataactattacacaaaagccatagatatgtgtcctaac
aatgccagctattacggtaatcgagcggccacactgatgatgcttggacggttccgggaa
gctcttggagatgcgcagcagtctgtgaggttggatgacagttttgtccggggacacctc
cgagaaggcaagtgccacctctcacttgggaatgcaatggcggcatgtcgtagtttccaa
agagccctagaactggatcataaaaatgcccaggcacagcaggagttcaagaacgccaat
gccgtcatggagtatgagaaaatagcagaagtggattttgaaaagcgagatttccggaag
gttgttttctgcatggaccgtgccctagaatttgcccctgcctgccatcgattcaaaatt
ctcaaagcagaatgtttagcaatgcttggtcgatacccagaagcacagtttgtggccagt
gacattttacgaatggattccaccaatgctgatgctctgtatgtccggggtctttgcctt
tattacgaagattgtattgagaaggcagtgcagttttttgtacaggctctcaggatggct
cctgaccacgagaaggcttgtgtcgcttgtagaaatgccaaagcccttaaagccaagaag
gaagatgggaataaagcctttaaggaaggaaattacaagctagcatatgaactgtacaca
gaagccttggggatagatcccaacaacataaaaacaaatgctaaactctactgtaatcgg
ggtacggttaattccaagcttaggcaactggaagatgccatagaagactgtacaaatgcg
gtgaagctcgatgacacttacatcaaagcctacctgagaagagctcagtgttacatggac
acagagcagtttgaagaagccgtgcgggactatgaaaaagtgtatcagacggagaaaaca
aaagaacacaaacagctccttaagaatgcacagctggaactgaagaagagcaagaggaaa
gattactacaagatcctgggagtggacaagaatgcctctgaggacgagatcaagaaagct
taccggaaacgggccttgatgcaccatccagatcggcacagtggggccagtgccgaagtt
cagaaggaggaggagaagaagtttaaggaagtgggagaggcctttaccatcctctctgat
cccaagaaaaagactcgttatgacagtggacaggacttggatgaggagggcatgaatatg
ggcgattttgatgcaaacaacatcttcaaggcattcttcggtggtcctgggggcttcagc
tttgaagcatctggcccagggaatttctactttcagtttggctaa

DBGET integrated database retrieval system