KEGG   Mus musculus (mouse): 56361Help
Entry
56361             CDS       T01002                                 

Gene name
Pus1, A730013B20Rik, MPUS1, mPus1p
Definition
pseudouridine synthase 1 (EC:5.4.99.12)
Orthology
K06173  
tRNA pseudouridine38-40 synthase [EC:5.4.99.12]
Organism
mmu  Mus musculus (mouse)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
MGI: 
Ensembl: 
Vega: 
UniProt: 
Position
5 F; 5
AA seq 441 aa AA seqDB search
MGFPRLWAALLRNWGRWTARPGPRVPGLPPMAGNKVPPALASHQPDRKGRGGWVWEETEH
PAKRVKGGEDEEPPRKLPKRKIVLLMAYSGKGYHGMQRNLGSSQFRTIEDDLVSALVQAG
CIPENHGTDMRKMSFQRCARTDKPLRTSACFCLYTGFLFHWGVSAAGQVVSLKVWLIDDI
LDKINSHLPSHIRILGLKRVTGGFNSKNKCDARTYCYMLPTFAFAHKDRDVQDESYRLSA
ETLQQVNRLLACYKGTHNFHNFTSQKGPREPSARRYILEMYCEEPFVREGLEFAVIKVKG
QSFMMHQIRKMVGLVVAIVKGYAPESVLERSWGEEKVDVPKAPGLGLVLERVHFEKYNQR
FGGDGLHEPLDWTQEEGKVTAFKEQYIYPTIVSTERDERSMAQWLNTLPIHNFSGTALGA
ADTGAKVPSSLEGSEGDGDTD
NT seq 1326 nt NT seq  +upstreamnt  +downstreamnt
atgggcttcccccgcctgtgggccgcactgctgagaaactggggacggtggacggcgcgc
ccaggcccgcgcgtgcccggcctgccgcctatggctggaaacaaggtgccaccagcgctg
gcctcacaccaaccggacaggaagggccgaggtggctgggtctgggaggagacggagcat
cctgcaaagagggtcaagggcggcgaggatgaagagcccccacgcaagctgccaaagcga
aaaattgtgctgctcatggcctactcgggcaagggctaccacggcatgcagaggaatctg
gggtcctcccagttcaggaccatcgaagatgacttggtatcggccttagtccaggcaggt
tgtatccctgaaaaccatggcacagatatgaggaagatgtccttccagcggtgtgctcga
acagacaagcctttgaggacctctgcctgcttttgcctgtacactggcttcctcttccac
tggggtgtgtctgcagcagggcaggtggtatccctaaaggtgtggctgattgatgacatt
ctggacaagatcaacagccaccttccatcccacattcggattctgggattgaagagggtc
acaggcgggttcaactccaagaacaagtgtgacgccaggacctactgctacatgctgccc
acctttgcctttgctcacaaggaccgggatgtacaggacgagagctatcgcctgagtgca
gagaccctgcagcaggtcaaccgccttctggcctgctacaaaggcacccataacttccat
aacttcacctcgcagaagggcccaagagagcccagtgcgcgccgctacattctggagatg
tactgcgaagagcccttcgtacgtgagggcctggagtttgctgtgatcaaggtgaagggc
cagagcttcatgatgcaccagatccggaagatggttggcctggtggtagccattgtgaag
ggttatgcccctgagagtgtcctggagcgcagctggggagaggagaaggtggatgtgccc
aaggcacccgggcttggcttagtcctggagagggttcactttgaaaagtacaatcaacgc
tttggcggtgacgggctgcatgagcccctggactggacgcaggaggaagggaaggtgact
gctttcaaggagcagtacatttaccctaccattgtcagcactgagcgggatgagcggtcc
atggcccagtggctcaatactttgccgatccacaacttcagtggcactgcacttggagcg
gctgacacaggtgccaaggtccccagttccctggagggcagtgaaggggatggagacact
gactga

DBGET integrated database retrieval system