KEGG   Mus musculus (mouse): 56361Help
Entry
56361             CDS       T01002                                 

Gene name
Pus1, A730013B20Rik, MPUS1, mPus1p
Definition
(RefSeq) pseudouridine synthase 1 (EC:5.4.99.12)
  KO
K06173  
tRNA pseudouridine38-40 synthase [EC:5.4.99.12]
Organism
mmu  Mus musculus (mouse)
Brite
Enzymes [BR:mmu01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.99  Transferring other groups
    5.4.99.12  tRNA pseudouridine38-40 synthase
     56361 (Pus1)
Transfer RNA biogenesis [BR:mmu03016]
 Eukaryotic Type
  tRNA modification factors
   Psudouridine synthases
    56361 (Pus1)
 Prokaryotic Type
    56361 (Pus1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
MGI: 
Ensembl: 
Vega: 
UniProt: 
Position
5; 5 F
AA seq 423 aa AA seqDB search
MGFPRLWAALLRNWGRWTARPGPRVPGLPPMAGNKVPPALASHQPDRKGRGGWVWEETEH
PAKRVKGGEDEEPPRKLPKRKIVLLMAYSGKGYHGMQRNLGSSQFRTIEDDLVSALVQAG
CIPENHGTDMRKMSFQRCARTDKGVSAAGQVVSLKVWLIDDILDKINSHLPSHIRILGLK
RVTGGFNSKNKCDARTYCYMLPTFAFAHKDRDVQDESYRLSAETLQQVNRLLACYKGTHN
FHNFTSQKGPREPSARRYILEMYCEEPFVREGLEFAVIKVKGQSFMMHQIRKMVGLVVAI
VKGYAPESVLERSWGEEKVDVPKAPGLGLVLERVHFEKYNQRFGGDGLHEPLDWTQEEGK
VTAFKEQYIYPTIVSTERDERSMAQWLNTLPIHNFSGTALGAADTGAKVPSSLEGSEGDG
DTD
NT seq 1272 nt NT seq  +upstreamnt  +downstreamnt
atgggcttcccccgcctgtgggccgcactgctgagaaactggggacggtggacggcgcgc
ccaggcccgcgcgtgcccggcctgccgcctatggctggaaacaaggtgccaccagcgctg
gcctcacaccaaccggacaggaagggccgaggtggctgggtctgggaggagacggagcat
cctgcaaagagggtcaagggcggcgaggatgaagagcccccacgcaagctgccaaagcga
aaaattgtgctgctcatggcctactcgggcaagggctaccacggcatgcagaggaatctg
gggtcctcccagttcaggaccatcgaagatgacttggtatcggccttagtccaggcaggt
tgtatccctgaaaaccatggcacagatatgaggaagatgtccttccagcggtgtgctcga
acagacaagggtgtgtctgcagcagggcaggtggtatccctaaaggtgtggctgattgat
gacattctggacaagatcaacagccaccttccatcccacattcggattctgggattgaag
agggtcacaggcgggttcaactccaagaacaagtgtgacgccaggacctactgctacatg
ctgcccacctttgcctttgctcacaaggaccgggatgtacaggacgagagctatcgcctg
agtgcagagaccctgcagcaggtcaaccgccttctggcctgctacaaaggcacccataac
ttccataacttcacctcgcagaagggcccaagagagcccagtgcgcgccgctacattctg
gagatgtactgcgaagagcccttcgtacgtgagggcctggagtttgctgtgatcaaggtg
aagggccagagcttcatgatgcaccagatccggaagatggttggcctggtggtagccatt
gtgaagggttatgcccctgagagtgtcctggagcgcagctggggagaggagaaggtggat
gtgcccaaggcacccgggcttggcttagtcctggagagggttcactttgaaaagtacaat
caacgctttggcggtgacgggctgcatgagcccctggactggacgcaggaggaagggaag
gtgactgctttcaaggagcagtacatttaccctaccattgtcagcactgagcgggatgag
cggtccatggcccagtggctcaatactttgccgatccacaacttcagtggcactgcactt
ggagcggctgacacaggtgccaaggtccccagttccctggagggcagtgaaggggatgga
gacactgactga

DBGET integrated database retrieval system