KEGG   Mus musculus (mouse): 56382Help
Entry
56382             CDS       T01002                                 

Gene name
Rab9, 2410064E05Rik, AI195561, Rab9a, Sid6061p
Definition
(RefSeq) RAB9, member RAS oncogene family
  KO
K07899  
Ras-related protein Rab-9A
Organism
mmu  Mus musculus (mouse)
Pathway
Measles
Brite
KEGG Orthology (KO) [BR:mmu00001]
 Human Diseases
  Infectious diseases
   05162 Measles
    56382 (Rab9)
GTP-binding proteins [BR:mmu04031]
 Small (Monomeric) G-proteins
  Rab Family
   Rab7/9 [OT]
    56382 (Rab9)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
MGI: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
X; X F5
AA seq 201 aa AA seqDB search
MAGKSSLFKIILLGDGGVGKSSLMNRYVTNKFDSQLFHTIGVEFLNKDLEVDGHFVTMQI
WDTAGQERFRSLRTPFYRGSDCCLLTFSVDDSQSFQNLSNWKKEFIYYADVKEPESFPFV
ILGNKTDIKERQVSTEEAQAWCKDNGDYPYFETSAKDSTNVAAAFEEAVRRILATEDRSE
HLIQTDTVNLHRKPKPNSSCC
NT seq 606 nt NT seq  +upstreamnt  +downstreamnt
atggcaggaaaatcgtctctttttaaaataattcttcttggagatggtggagttggcaag
agttctcttatgaacagatatgtaaccaataaatttgattcccagctcttccacacaata
ggtgtggaatttttaaataaagatctggaggtggacggacattttgttaccatgcagatt
tgggacacagctggccaagaacgcttccgaagcctgaggacgccattttaccggggttct
gactgttgcctgcttacatttagtgtcgatgattcacagagcttccagaatttgagcaac
tggaagaaagagttcatatattacgcagatgtgaaagagcctgaaagctttccctttgtg
attttgggcaacaagactgacataaaagaacggcaggtgtctacagaagaagcccaagcc
tggtgcaaggacaacggcgactatccttactttgaaacaagtgcaaaagattccaccaat
gttgctgctgcctttgaggaggcagttcgaagaattctggccacggaagataggtcagaa
cacctgattcagacagacacagtcaatctgcaccgaaagcccaagccaaactcatcttgc
tgttga

DBGET integrated database retrieval system