KEGG   Mus musculus (mouse): 56388Help
Entry
56388             CDS       T01002                                 

Gene name
Cyp3a25, AI327008
Definition
cytochrome P450, family 3, subfamily a, polypeptide 25 (EC:1.14.14.1)
Orthology
K07424  
cytochrome P450, family 3, subfamily A [EC:1.14.14.1]
Organism
mmu  Mus musculus (mouse)
Pathway
Steroid hormone biosynthesis
Linoleic acid metabolism
Retinol metabolism
Metabolic pathways
Chemical carcinogenesis
Brite
KEGG Orthology (KO) [BR:mmu00001]
 Metabolism
  Lipid metabolism
   00140 Steroid hormone biosynthesis
    56388 (Cyp3a25)
   00591 Linoleic acid metabolism
    56388 (Cyp3a25)
  Metabolism of cofactors and vitamins
   00830 Retinol metabolism
    56388 (Cyp3a25)
 Human Diseases
  Cancers
   05204 Chemical carcinogenesis
    56388 (Cyp3a25)
Enzymes [BR:mmu01000]
 1. Oxidoreductases
  1.14  Acting on paired donors with incorporation of molecular oxygen
   1.14.14  With reduced flavin or flavoprotein as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.14.1  unspecific monooxygenase
     56388 (Cyp3a25)
Cytochrome P450 [BR:mmu00199]
 Cytochrome P450, animal type
  CYP3 family
   56388 (Cyp3a25)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
MGI: 
Ensembl: 
Vega: 
UniProt: 
Position
5 G3; 5 85.17 cM
AA seq 503 aa AA seqDB search
MELIPNLSIETWVLLVTSLVLFYIYGTYSHGLFKKLGIPGPKPLPLLGTIFNYYDGMWKF
DEDCYKKYGKIWGFYEGPQPILAIMDPEIIKIVLVKECYSVFTNRRFFGPVGFMKKAITI
SEDEEWKRLRTLLSPTFTSGKLKEMFPIMRQYGDILVRNLRREEEKGEPISMKDIFGAYS
MDVITGTSFGVNVDSLNNPQDPFVQKAKKILKFKIFDPFLLSIILFPFLTPIYEMLNFSI
FPRDSMNFFKKFVKRMKKERLASNQKNRVDFLQLMMNTQNSKGQESQKALSDLEMAAQAV
IFIFGGYDATSTSISLIMYELATHPDVQKKLQDEIDRTLPNKAPVTYDALMDMEYLDMVV
NESLRLYPIAIRLERVSKKDVEINGVFIPKGTVVMIPIYPLHRNPEYWPEPQEFCPERFS
KENKGNIDPYIYMPFGNGPRNCIGMRFALISIKLAVIGVLQNFTVQPCEETQIPLKISRE
PIFQPEKPIILKVVSRDKPRTGS
NT seq 1512 nt NT seq  +upstreamnt  +downstreamnt
atggagctcatccccaacctttctatagaaacctgggtgctgctggttactagcctggtg
ctcttctacatatatgggacctattctcatggcttgtttaagaaactaggaattcctgga
ccaaaacctctaccgttacttggcaccattttcaactactatgatggcatgtggaaattt
gatgaagattgctataaaaagtatgggaaaatatgggggttttatgagggcccacagcct
atattggctatcatggatccagagatcatcaagattgtgctggtgaaagaatgttactca
gtcttcacaaaccgtcggttttttgggccagtgggattcatgaaaaaggccattaccata
tctgaggatgaagaatggaagagacttagaacactcctgtctccaaccttcaccagtggc
aaactcaaggagatgttccccatcatgagacagtatggagatatattggtgagaaacttg
agacgagaagaagagaaaggggagcccatcagtatgaaagacatctttggagcttatagc
atggatgtgatcactggcacatcatttggcgtgaacgtcgattccctcaataatccacag
gatccctttgtgcagaaagccaagaagatcttaaaatttaaaatttttgatccatttctt
ctgtctataattctgtttccatttcttactccaatatatgagatgttaaacttttccatt
tttccaagagattcaatgaactttttcaaaaaatttgtaaaaaggatgaagaaagaacgc
cttgcttcaaaccagaagaaccgagtggattttctacaactgatgatgaatactcagaac
tccaaaggccaagagtcacagaaagctctttctgatctagaaatggcagcacaagctgtt
atttttatcttcgggggctatgatgccacaagcacttccatttccctcataatgtatgaa
ctggccactcaccctgatgtgcaaaaaaaacttcaggatgagattgacagaactctgccc
aataaggcacctgtcacctatgacgccctgatggacatggagtacctggacatggtggtg
aatgaaagtctaagattgtacccaattgctatcaggctagaaagggtctcaaaaaaagat
gtggaaatcaatggagtgttcattcccaaagggaccgtagttatgataccaatctatcct
cttcaccgaaatcctgagtactggccagagcctcaggaattctgccctgaaaggttcagc
aaggagaacaagggcaacattgatccatatatatacatgccctttggaaatggacccagg
aactgcataggcatgaggtttgctctcatcagcatcaaacttgctgtcataggagtcctg
cagaacttcactgtccagccttgtgaagagacacagatccccctgaagatcagcagggaa
ccaattttccaaccagaaaaacccatcatcctaaaggttgtgtcaagagataaacccaga
actggatcatga

DBGET integrated database retrieval system