KEGG   Mus musculus (mouse): 56398Help
Entry
56398             CDS       T01002                                 

Gene name
Chp1, 1500003O03Rik, AA960066, AI046351, Cahp, Chp, Sid470p, p24, vac
Definition
calcineurin-like EF hand protein 1
Orthology
K17610  
calcineurin B homologous protein 1
Organism
mmu  Mus musculus (mouse)
Brite
Protein phosphatases and associated proteins [BR:mmu01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Calcineurin (PPP3/ PP2B)
    Regulatory subunits
     56398 (Chp1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
MGI: 
Ensembl: 
Vega: 
UniProt: 
Position
2 E5; 2
AA seq 195 aa AA seqDB search
MGSRASTLLRDEELEEIKKETGFSHSQITRLYSRFTSLDKGENGTLSREDFQRIPELAIN
PLGDRIINAFFSEGEDQVNFRGFMRTLAHFRPIEDNEKSKDVNGPEPLNSRSNKLHFAFR
LYDLDKDDKISRDELLQVLRMMVGVNISDEQLGSIADRTIQEADQDGDSAISFTEFVKVL
EKVDVEQKMSIRFLH
NT seq 588 nt NT seq  +upstreamnt  +downstreamnt
atggggtctcgggcctccacgttattgcgggacgaagagctcgaggagatcaagaaggag
actggcttttcccacagtcagatcacgcgcctgtacagccgcttcaccagcctggacaaa
ggggagaacgggactctcagccgggaagatttccagaggattccagaacttgccatcaac
ccactgggggaccggatcatcaatgccttcttctcagagggagaggatcaggtaaacttc
cgaggattcatgagaacattggctcatttccgacccattgaggataacgaaaagagcaaa
gatgtgaatggcccggaacccctcaacagccggagcaacaagctgcactttgctttcaga
ctctatgatttggataaagatgacaagatctcccgtgatgagctgttacaggtactgcga
atgatggttggagtgaatatctcggatgagcagctgggcagtattgcggacaggaccatc
caggaggctgaccaagatggagatagtgccatatcttttacagaattcgttaaggttttg
gaaaaagtggatgtagaacagaagatgagcatccgatttcttcactaa

DBGET integrated database retrieval system