KEGG   Mus musculus (mouse): 56420Help
Entry
56420             CDS       T01002                                 

Gene name
Ppp4c, 1110002D08Rik, AU016079, Ppx
Definition
(RefSeq) protein phosphatase 4, catalytic subunit (EC:3.1.3.16)
  KO
K15423  
serine/threonine-protein phosphatase 4 catalytic subunit [EC:3.1.3.16]
Organism
mmu  Mus musculus (mouse)
Pathway
Glucagon signaling pathway
Brite
KEGG Orthology (KO) [BR:mmu00001]
 Organismal Systems
  Endocrine system
   04922 Glucagon signaling pathway
    56420 (Ppp4c)
Enzymes [BR:mmu01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.16  protein-serine/threonine phosphatase
     56420 (Ppp4c)
Protein phosphatases and associated proteins [BR:mmu01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-4
    Catalytic subunits
     56420 (Ppp4c)
DNA repair and recombination proteins [BR:mmu03400]
 Eukaryotic Type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    Protein phosphatase 4
     56420 (Ppp4c)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
MGI: 
Ensembl: 
Vega: 
UniProt: 
Position
7; 7 F3
AA seq 307 aa AA seqDB search
MAEISDLDRQIEQLRRCELIKESEVKALCAKAREILVEESNVQRVDSPVTVCGDIHGQFY
DLKELFRVGGDVPETNYLFMGDFVDRGFYSVETFLLLLALKVRYPDRITLIRGNHESRQI
TQVYGFYDECLRKYGSVTVWRYCTEIFDYLSLSAIIDGKIFCVHGGLSPSIQTLDQIRTI
DRKQEVPHDGPMCDLLWSDPEDTTGWGVSPRGAGYLFGSDVVAQFNAANDIDMICRAHQL
VMEGYKWHFNETVLTVWSAPNYCYRCGNVAAILELDEHLQKDFIIFEAAPQETRGIPSKK
PVADYFL
NT seq 924 nt NT seq  +upstreamnt  +downstreamnt
atggcggagatcagcgacctggaccggcagatcgagcagctacggcgctgcgagctgatc
aaagagagcgaagtcaaggccctgtgcgccaaggccagagaaatcttggtagaagagagc
aacgtgcagagggtggactcgccagtcacagtatgcggtgacatccatggacaattctat
gacctcaaggagctgttcagagtaggtggcgatgtccctgagaccaactacctcttcatg
ggagactttgtggaccgtggtttctacagtgttgaaaccttcctcctcctgctggctctt
aaggttcgctatcctgacagaatcactttgatccggggcaatcatgagagtcgccagatt
acccaggtctatgggttctatgatgagtgcttacggaaatatggttcagtgactgtatgg
cgctactgtactgagatctttgactacctcagcctgtctgccatcattgatggcaagatc
ttctgtgtgcatggaggtctttccccttccatccagaccttggaccagatccggacaatt
gaccgaaagcaagaggtaccccatgatggacccatgtgcgacctcctgtggtctgaccct
gaagacacaacaggctggggagtgagcccccgcggggcaggttacctgtttggcagtgac
gtggtcgcccagttcaatgcagccaacgacattgatatgatctgccgtgcccaccaatta
gtgatggaaggctacaagtggcacttcaatgagaccgtgcttactgtgtggtcagcgcct
aattactgctaccgctgtggcaatgtggcagccatcttagaactggatgagcacctccag
aaagatttcatcatcttcgaggctgcaccccaagagacacgtggcatcccctccaaaaag
ccagtggccgactatttcctgtga

DBGET integrated database retrieval system